KEGG   Bifidobacterium longum subsp. longum JDM301: BLJ_0061Help
Entry
BLJ_0061          CDS       T01240                                 

Definition
(GenBank) hypothetical protein
Organism
bll  Bifidobacterium longum subsp. longum JDM301
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Halogen_Hydrol Herpes_UL36
Motif
Other DBs
NCBI-ProteinID: ADG99557
UniProt: D6ZXB1
Position
82237..82944
Genome map
AA seq 235 aa AA seqDB search
MLQVICGFVVGLLLAGLGFGLAGGGVPGLIVAVVLAALGYIAASTLTEPERRIGKMLVSA
LPNGQKAADTIDAANARLNSIAMLTKQVRDPAVKAEANDFIAATKDLVQYVTRDTSAYPT
LRHYITVYGEQTEKLLRSYVDVESSGARDQIATARIETIEALQVLEQTAAGELSRAVSAK
TLGITADSDAIQRLARMGGYDDVAPSPVPFSAADEGRHAPSQGPAHQSDQKTDAQ
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgctccaggtaatctgtggattcgttgtcggactgctgctcgccgggctcggcttcggg
ctggccggcggcggagtgcccggcctgatcgtggccgtggtgctggccgcactcgggtat
atcgccgcctccacgctcaccgagccggagcgacgcatcggcaaaatgctggtttccgcc
ctgcccaacggtcagaaggccgccgatacgatcgacgcggcgaacgctcgactcaactca
atcgccatgctcaccaagcaagtacgtgacccagccgtcaaagccgaagccaatgacttc
atcgccgctaccaaagatttagtgcaatacgtgacccgagacacctccgcctacccgacg
ttgcgccactacatcaccgtgtacggcgagcagaccgagaaactgttgcgctcctacgtg
gacgtggaaagttccggcgcacgcgatcagatagccacggcacgaatcgaaaccatcgag
gcgctgcaagtgctcgaacagaccgccgccggcgaactcagccgggcggtaagcgccaag
acgttgggcattacggccgactccgacgccatccaacggttggcccgcatgggtggatac
gacgacgtcgcaccttcgcctgtgcctttctcggctgccgatgaaggacggcatgcaccc
agtcagggcccggctcaccagtcggaccagaaaacggacgcacaatga

DBGET integrated database retrieval system