KEGG   Bifidobacterium longum subsp. longum JDM301: BLJ_0064Help
Entry
BLJ_0064          CDS       T01240                                 

Definition
(GenBank) heat shock protein Hsp20
Organism
bll  Bifidobacterium longum subsp. longum JDM301
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP20 WxL
Motif
Other DBs
NCBI-ProteinID: ADG99560
UniProt: D6ZXB4
Position
85775..86278
Genome map
AA seq 167 aa AA seqDB search
MAMFPALMNDTMFSDLFDDPFFEGWRNTDNTMSAAMPANMMTTDVRETDKGYDVDIDMPG
FKKEDINLELNNGYLTVSASRCSEHEDKAPAAEGEASDSKCACASDSGKWLRRERYMGSC
SRSFYVGEDVKESDIHASYRNGTLCIQVPKMQAQPQVESKHQIAIEG
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atggcaatgtttccggctttgatgaatgacacgatgttctcggatctgttcgatgatccg
ttctttgagggttggcgcaacacggacaacacgatgagtgccgcaatgcctgccaacatg
atgaccaccgatgtgcgcgagaccgacaagggttacgacgtcgacatcgatatgcctggc
tttaagaaggaagatatcaaccttgagctcaacaacggctatctgaccgtgtccgcctcg
cgttgcagcgagcatgaggacaaggctccggccgctgagggcgaggcttccgacagcaag
tgcgcttgcgcgtccgattcgggcaagtggctgcgtcgcgaacgctacatgggctcctgc
tcgcgtagtttctacgttggcgaggacgtgaaggagtccgacatccacgccagctaccgg
aacggcacgctgtgcatccaggttccgaagatgcaggcccagccgcaagtcgagtccaag
caccaaatcgcgattgagggctga

DBGET integrated database retrieval system