KEGG   Bifidobacterium longum subsp. longum JDM301: BLJ_0066Help
Entry
BLJ_0066          CDS       T01240                                 

Definition
(GenBank) hypothetical protein
Organism
bll  Bifidobacterium longum subsp. longum JDM301
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACR_tran ABC_membrane DUF3040 FA_desaturase DUF2207 DUF4191 PrgI
Motif
Other DBs
NCBI-ProteinID: ADG99562
UniProt: D6ZXB6
Position
complement(87730..88188)
Genome map
AA seq 152 aa AA seqDB search
MLVDMTHANEQRPAATGNVADNVSDAPTDPATSAAARPMTGTADGTTATNAAASSTAKPA
ASTSWTRETNPRRALLTIIVTVVVVVAIVLGLGFFVNWGLAALSVIIMIPGAISLAVLAK
HPESTGGRSMFGISDPNTLLDPIRRPSERRGE
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgttggtggatatgactcacgcaaacgaacaacgtccagcagcgaccggcaatgtcgcc
gataacgtgtctgacgcccctactgaccccgcgacgagcgcggcggcaaggcccatgacc
ggcacggctgatggcacaacagccacaaacgccgcggccagttcaacagcaaaacccgca
gccagcacctcttggaccagggaaaccaacccacgtcgagcactgttgacgattatcgtc
acggtggtggttgtggtggccatcgtactggggctcggattcttcgtgaactggggattg
gcggccctttcggtgatcattatgattccgggggcgatttcgctggccgttctcgccaag
caccctgaatccaccggcgggcgcagcatgttcggcatctccgatccgaatacgctgctt
gacccgattcgccgcccgtccgagcgccgcggcgagtaa

DBGET integrated database retrieval system