KEGG   Bifidobacterium longum subsp. longum JDM301: BLJ_0068Help
Entry
BLJ_0068          CDS       T01240                                 

Definition
(GenBank) protein of unknown function DUF470
Organism
bll  Bifidobacterium longum subsp. longum JDM301
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2156 DUF2569
Motif
Other DBs
NCBI-ProteinID: ADG99564
UniProt: D6ZXB8
Position
89975..92659
Genome map
AA seq 894 aa AA seqDB search
MSEEQQHGNARPAAMPQTRRPLRDAEPSRTKPATTSRATKPHTARSSHAAESWRELAGDV
RQWADDHRLAVTATATLVALNLAAWLVAAMAGFAFPLRLSTSMAAFNAGKLICSLFLARG
VIQLMVDAVLWLVMLSIAEPWLGRVRTVVTALACAAGGVLAGLTLCAAAGWMFQDSLFVS
RMRFALSPLVLPVGALMAASAFCSHLWRRRIRLVGYVAILVTLLYSGNPSGYCILAAALI
GHAAGRVMAGPPAHVETEWHWLRSTSFEARRIFAAIAVVLALGPVIAITSHNHAGPLSTI
GLLMSPVSVDDGMLAECLAGDTHSGCFLQFDLLRASMPGAVLRSLLPTAVTLVLAWGLYR
GRRFAAICTVAINLFTVAIAVAYYLVVPLSFAPDGMASLLQHGAIVACVANVLPPLLFAI
ALLAAMKHFPIRIGWCRLVGGIGAIVLAWLACAAIYLIYGIAQPATFSPRATASSLLAEL
PGRFLPIGFLSHMKLSFVPRTPMASIMYQGVGLVFWIVVLAVVIHWMGDVSESNERARAR
AERLVETGGESMSFMTTWEGNSYWLSPTGRSAVAYRVLNGIALTCTGPFGDPAEWMDDLN
GFAQHCAERSLSPVFYGVHREQRDALLEAGWNSIEVGSEMVVDPRGWKTTGKKWQDVRTA
INKAKRDGVTDVQSTFLEASLDVREQIEDISEEWAQLKALPEMKFTLGGVEELRDPRVRL
LYAIDADGRVLGVTSWLPTWRDGRIVGWTLDFMRHRTDSPNGIMEFLIARMAERLRDEGE
ADPAHAVEFMSLSAAPLAGMNPDRDNAGEDGAPASEGTQVLQHALQIVADWMEPAYGFHS
LFNFKRKFQPTEAPVYVCYPDPAALPQIGLAVVRAYVPSVTPAEVAGMLSTLRS
NT seq 2685 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaagaacaacagcatgggaacgcgcggccggcggccatgccgcagacgcggcgg
cccctgcgggacgcggaaccctcgcggacgaagcccgccacgacctcccgcgccaccaaa
ccacatacggcaaggtccagccatgcggcggaaagctggcgtgaactggccggtgacgtg
cggcagtgggcggacgatcaccggttggccgtcaccgccacggcgacgctggtggcgctg
aatctggcggcgtggctggtggccgcgatggccggattcgcgtttccgctgcggctcagc
accagcatggccgcattcaacgccggcaaactcatctgctcgctgttcctggcgcgcggc
gtcatccaactcatggtcgacgccgtcctgtggctcgtcatgctgtcgatagccgaacca
tggctcggccgtgtgcgcaccgtcgtcaccgcgctcgcctgcgcggccggcggcgtgctg
gcgggcctgaccctgtgcgcggcggccggatggatgttccaggactccctgttcgtctcc
cgcatgcggttcgcattgagcccgctggtgttgccggtcggcgcgctcatggcggccagc
gcgttctgcagccacctatggcgcaggcgcatccgactcgtcggctatgtggcgatcctg
gtcacgttgctctacagcggcaaccccagcggctactgcatactcgccgccgcgctgatc
ggccatgccgccggccgtgtgatggccgggccgcccgcgcacgtcgaaaccgaatggcac
tggctgcgcagcacctccttcgaggcgcggcgcatattcgcggccatcgccgtggtactg
gccctggggccggtcatcgccatcacctcccataaccatgcgggcccgctcagcacgatc
ggcctgctcatgagcccggtttccgtcgacgatggcatgttggccgaatgcctggccggt
gacacgcacagcggatgcttcctgcagttcgatctgttgcgggcctcgatgcccggcgcg
gtgctgcgctcgctgctgcccacagccgtgaccttggtgctggcgtggggcctgtatcgc
ggacgtcggttcgcggccatctgcaccgtggccatcaacctgttcacggtggccatcgcc
gtcgcctactatctggtcgtgccgctgagcttcgcgccggacggcatggcctccctgctg
cagcacggcgcgatcgtggcctgcgtggcgaacgtcctgcccccgctgctgttcgccatc
gccctgctggcggcgatgaaacacttcccgatccgcatcggctggtgcaggctggtcggc
ggcatcggcgccatcgtgctggcctggctggcgtgcgccgccatatacctgatatacggc
atcgcccaacccgccaccttctcgccacgcgctacggcctcgtcgctgctggccgagctg
ccgggacgcttcctgcccatcggcttcctgagccatatgaagctgtcgttcgtgccgcgc
actccgatggcctcgatcatgtaccaaggcgtcgggctggtgttctggatcgtggtgctg
gccgtggtgatccactggatgggcgacgtgagcgaatcgaacgagcgagcccgggcgcgc
gccgaacgtctggtcgaaaccggcggcgaatcgatgagcttcatgaccacgtgggaaggc
aacagctactggctgtcccccacgggcagatcggccgtggcgtatcgcgtgctcaacggc
atcgccctgacctgcaccggaccgttcggcgatccggcggaatggatggacgatctgaac
ggtttcgcccagcactgtgcggaacgttcgctgtcgccggtgttctacggcgtgcatcgg
gaacagcgcgacgcgttgctggaagccggctggaactccatcgaggtcggcagcgaaatg
gtggtcgacccgcgcggctggaagacgaccggcaagaaatggcaggacgtgcgcaccgcc
atcaacaaggccaagcgcgacggcgtgaccgacgtgcagtccaccttcctggaagcgtcg
ctcgatgtgcgcgaacagatcgaggacatctccgaggagtgggcgcagctcaaggcgctg
ccggaaatgaagttcacgctcggcggcgtcgaggaactgcgcgacccgcgcgtgcggctg
ctttacgccatcgacgcggacgggcgcgtgctgggcgtcaccagctggttgcccacctgg
cgcgacgggcgcatcgtcggctggacgttggatttcatgcgccatcgcaccgacagcccc
aacggcatcatggagttcctgatcgcgcgcatggccgagcgtctgcgcgacgagggcgaa
gccgatcccgcgcacgccgtggagttcatgagcctgtccgcggcgcccctggccggcatg
aatcccgatcgggacaacgccggggaggacggggcaccggccagcgaaggcacgcaggtg
ctccaacacgcgctgcagatcgtggccgactggatggaacccgcctacggcttccactcg
ctgttcaacttcaagcgcaagttccagcccaccgaagcgccggtctacgtgtgctacccg
gacccggcggcgttgccgcagatcgggctcgcggtggtgcgcgcctacgtgcccagcgtg
acgcccgccgaagtggccggcatgctcagcacgctgcggtcgtga

DBGET integrated database retrieval system