KEGG   Bifidobacterium longum subsp. longum JDM301: BLJ_0072Help
Entry
BLJ_0072          CDS       T01240                                 

Definition
(GenBank) DNA repair helicase Rad25
Organism
bll  Bifidobacterium longum subsp. longum JDM301
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(95844..99050)
Genome map
AA seq 1068 aa AA seqDB search
MSINLVSTSDSPANTQHHDSDPTPSILEDVISGLIEPRSDAPGEYKPTLIANRPGGLTMH
EEIGNSLATSDSFDISVAFVSAEAVLSLFEDFRSHHETATRAGTLITSTKNHFNDPRAFW
ELLHLQNTTGVDVRVWEGSRNTSVSAMAQGQPFHPKGYIFSRRMKDGTPYYDLYVGSSNL
TGAALTTQREWNLKVSSLADGELVGQFQDEIDSQVADSVPLTEEWIKQYEEDFKKYAPPR
HEILQSLEGHDIQPNAMQQEALANLKKIREQGEHRAIIVSATGTGKTYLSAFDVRECQPK
RMLYIAQQQMILQTAMKSYQKVLGCDESELGLYSGTSKQQDRRYVFATVQTMRQPEVLAQ
FKSDEFDYVLVDEVHHAGAEGYQRVINHFKDADFMLGMTATPERTDGINIFELFGHNIAY
EIRLQKALDENMLCPFHYYGVAEYLGSNDDPNGIAHRLDVSKGLDAKDSKQLKYEIEQLA
TEKRVRYIIDKLQEYGQFNIPVTGLVFCSRQEEAHKLSQLFNQQWNQQAERPYRTAAVTS
TDDDGRPVSQTQRDEYVRKLIEGELDYLFTVDMFNEGVDIPAVNQIVMLRSTESSIIFTQ
QLGRGLRKFPHKESVVVIDFIGNYNNNYLIPVALYGNTGDRDRARKNLQRKSIGLSSISF
DPIAKERILKSLGAADWSDMKKLSEQYRQVRYELGRIPMLTDIYNYDPSLPYTIASKRSN
YLDFVRSREKSLGKGKHHEATFEDQLEPVTDVEDAILKMAAELLLPGLRPHELVILAQLC
HFVSERLDDDVPQHWSAGSPIGRSELLDAIRTEFPQSDGSDTQFDSAISVLDYSYFTGPN
CNRFGNQPLVEAANSTGTENGTAYRLNSRFADMLATNRTFRIFFADTLRTGMANCRDIFR
EAAARQQVFDHMFLYERKYSMADVMRLCGWKKENTPQNVGGYLLDKETNTMPIFVKYAAS
QYEDEFLSTQEMKYFSKNGRTPQSPEFRWALNGIGPNWGQTHFVPLFVMRKAEEAEGKYY
YVGHVAAFDNPQLTTKPDASGQGSVKVTLSILRLARPIDLELYRHLVS
NT seq 3207 nt NT seq  +upstreamnt  +downstreamnt
atgtctataaatctggtcagcacctcagactctccagccaacacgcaacatcacgattct
gatccaaccccctcgatcctcgaagatgtcatctcaggtctgatcgagccgcgctcagat
gctcccggcgaatataagccgaccctcatcgcaaatcgccccggtggattgaccatgcac
gaggaaatcggcaattccttggctactagcgattccttcgacatttctgtcgcattcgtc
tcggctgaggccgtgctcagcttatttgaagacttcagaagtcaccatgaaacagcgacc
cgagcgggcacactgattacctcaacgaaaaatcatttcaacgatcccagggcattctgg
gagctgctgcatcttcagaacaccactggtgttgacgttcgcgtgtgggaaggttcccgt
aatacctcagtttccgcaatggctcaaggacaaccattccatcccaagggatatatcttt
tctcgccgcatgaaagacggcacaccctattacgacctgtacgttggcagttccaatctc
actggagccgcattgaccacgcaacgcgaatggaatctcaaagtctcatcgctggcggat
ggagagctggtcgggcagttccaggatgaaatcgactcacaggtggctgattccgttccg
ctgaccgaagagtggatcaaacagtatgaggaagatttcaagaaatacgccccaccgcgt
catgagattctgcagtcgcttgaggggcatgacattcagccaaacgccatgcaacaggag
gcgttggcgaatctcaagaagattcgtgaacaaggcgagcaccgcgcaattatcgtgtcg
gccaccggcaccggaaagacgtacctttccgcattcgacgtacgcgaatgccagccgaag
cgcatgctgtacatcgcccagcagcagatgattcttcaaactgcaatgaagtcttaccaa
aaggtgctcggctgcgatgaatccgaattgggattgtattcaggcaccagcaagcaacag
gaccgccgctacgtattcgccacggtacagacgatgcggcagccggaggttttggcgcaa
ttcaaatccgatgaattcgactacgttctggttgacgaagttcatcacgctggagccgaa
ggatatcagcgcgtcatcaatcatttcaaagatgccgacttcatgctcggcatgaccgcc
acgccagagcgcaccgacggcatcaacatcttcgagctattcgggcataacatcgcgtac
gaaattcgcttgcaaaaggcgttggacgagaacatgctctgtccattccactactacggt
gttgcggaataccttggctccaacgacgatccgaatggaatcgcccatcgtctcgatgtc
tccaagggccttgatgcgaaggactcgaaacagctcaagtacgagatcgagcagcttgcc
accgaaaagcgagtccgctacatcattgacaagttgcaggaatatgggcagttcaacatt
ccggtcaccggactcgtgttctgcagtcgacaggaggaagcccataagctatcccagctg
tttaaccaacagtggaatcaacaagccgaacgcccctatcgcaccgctgccgttaccagc
acggacgatgacggcaggcccgtgtcccaaacgcagcgagacgaatacgtccgcaagctc
attgaaggcgaactcgactatctcttcactgtcgatatgttcaatgagggagttgatatt
cccgccgtcaaccaaatcgtcatgttgcgcagcaccgaatccagcattatcttcacgcag
cagctcgggcgcggactgcgcaaattcccgcacaaagaaagcgttgtggttatcgatttc
attggcaattacaacaacaactatctgattccggtggcattatacggcaacaccggcgac
cgcgacagagctcgcaagaacctgcagagaaagtcaatcggcctgtcgtccatcagtttc
gacccgatcgccaaggagcgcatccttaagtctttgggcgccgccgactggtccgacatg
aaaaagctgtccgaacagtatcgccaagtccgttacgagctgggccgcatccccatgctt
acggacatctataactacgacccctcactgccgtataccatcgcatcgaagcgcagcaac
tatcttgatttcgtgcgttcccgtgaaaaaagcctgggcaaaggcaaacatcatgaagcg
acatttgaggatcagttggagccggtgaccgacgttgaagacgcgatactcaagatggca
gcggagctgctgctgcccggattgcgaccgcacgaattggtcattcttgctcagctatgc
catttcgtcagcgaacggctcgacgacgacgtaccgcagcattggagtgcgggctcgcca
atcggccgcagcgaattgctcgatgcgattcgtactgaattcccgcagtccgatggttca
gacacgcaattcgactctgcgatcagcgtgctcgattactcatatttcaccggcccaaac
tgcaatcgtttcggcaatcagccattagtcgaagccgcgaacagcaccggcacagaaaac
ggtaccgcatatcgattgaacagcagattcgccgatatgcttgccacgaacagaacgttc
cgtatcttctttgcggacactctgcgcaccggtatggccaattgccgagatatattccgt
gaggccgccgccaggcaacaggtctttgaccacatgttcttgtacgaacgcaaatattcc
atggcagacgtcatgcgactgtgcggatggaagaaggagaatactccgcaaaacgtgggt
ggttacctcctcgacaaggaaaccaataccatgcccatcttcgtgaaatacgcggcaagt
caatacgaagatgaattcctgagcacacaggaaatgaaatacttcagcaagaatggacga
actccgcagtctcccgaattccgatgggcgcttaacggcattggcccgaattggggccag
acgcatttcgtcccgttattcgttatgcgcaaggcggaagaagccgagggtaagtactac
tacgttggccacgttgccgcgtttgacaaccctcagctcaccaccaaacctgacgcaagc
ggacaaggcagcgtgaaggtcacactgtcgatcctgcggttggcccggccaatcgatctg
gagctctatcggcatttggtcagctga

DBGET integrated database retrieval system