KEGG   Bifidobacterium longum subsp. longum JDM301: BLJ_0075Help
Entry
BLJ_0075          CDS       T01240                                 

Definition
(GenBank) possible acetyltransferase
Organism
bll  Bifidobacterium longum subsp. longum JDM301
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
100175..100690
Genome map
AA seq 171 aa AA seqDB search
MTIRIEAYDRLPDAARAIREQVFIRERDWRPEFDEWDAASAHLLVFDSDNDAPNRPGSSA
QLASRSQPIQPDQNRPVATCRFYADPDHPDQPGRYIIARLAVLPEAQGRHIGSRLLADAE
RRIAQAGGTMAAVHSENDHYKFYEQRGYRLTDEVYEGGRHGWLVKDLSRNV
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgaccatacgaatcgaagcatacgaccggctgcccgacgcggcccgcgccatccgcgag
caggtgttcatccgcgaacgcgactggcggccggaattcgatgaatgggatgccgcgtcc
gcgcatctgctggtgttcgattcggataatgatgcgcccaatcgccctggctcgtccgcg
caattggcctcacgcagccagcccattcagcccgaccagaatcgccccgtggcgacttgc
cggttctatgcggaccccgaccatcccgaccaacccgggcgatacatcatcgcgcgactg
gcggtgctgcccgaggcgcaaggcaggcacatcggctcgcggctgctggccgacgccgaa
cgccgcatcgcgcaagccggcggaaccatggccgccgtgcactcggagaacgaccactac
aagttctacgaacagcgcggctaccggctcactgacgaggtctatgaaggcggccgtcac
ggctggctggtcaaggacctatctcgtaacgtatga

DBGET integrated database retrieval system