KEGG   Bifidobacterium longum subsp. longum JDM301: BLJ_0077Help
Entry
BLJ_0077          CDS       T01240                                 

Definition
(GenBank) hypothetical protein
Organism
bll  Bifidobacterium longum subsp. longum JDM301
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADG99573
UniProt: D6ZXC7
Position
complement(101681..101917)
Genome map
AA seq 78 aa AA seqDB search
MNRDETNEVSGVADDQLGRTAEPYESDNWRGGVESIIRSNPKSGTDTSRTQQTRIIRVHR
LSDVFRDRTTEYHTTEEL
NT seq 237 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgagacgaaaccaacgaagtatctggagtcgccgacgaccagctcggccgaacg
gccgagccgtacgaatccgacaactggcggggcggcgtcgagagcatcattcgcagcaat
ccgaaatcaggaaccgacacaagtcggacccagcagacacgcataatacgagttcacaga
ctcagcgatgtattccgcgaccgcaccaccgaataccacaccacggaagaactgtaa

DBGET integrated database retrieval system