KEGG   Bifidobacterium longum subsp. longum JDM301: BLJ_0079Help
Entry
BLJ_0079          CDS       T01240                                 

Definition
(GenBank) queuine tRNA-ribosyltransferase
  KO
K00773  
queuine tRNA-ribosyltransferase [EC:2.4.2.29]
Organism
bll  Bifidobacterium longum subsp. longum JDM301
Brite
Enzymes [BR:bll01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.29  tRNA-guanosine34 transglycosylase
     BLJ_0079
Transfer RNA biogenesis [BR:bll03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    BLJ_0079
 Prokaryotic Type
    BLJ_0079
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(102826..104139)
Genome map
AA seq 437 aa AA seqDB search
MTISLLEHPLGAQPGQPGDRSAFHFETITRLPSTASGLGRDGARYGRTGIIHTPHGDIRT
PAFVPVGTQAAMKAVLPEQMKDLGAQCLLANAFHLFERPGEDVLDAAGGLANFMNWDGPT
FTDSGGFQVMSLGVGFKKTLAMDVTGMKSDDIIAKGKERMAWVDEDGVTFKSPLNGDAHR
FSAEISMGIQHKIGADIMFAFDELTTLMNTRSYQEDSVERTFRWARRCVDEHQRLTAERL
GKPYQALYGVVQGANYEDLRRRAASQIASLDFDGVGIGGAIEKRIIGDTCAWICDAMPEN
RPRHVLGIASVDDIFACVENGGDTFDCVAPARCARNGAIYTRAGRYNIKRAQHKFDFGPL
EEGCDCYTCQHYSRAYVDHLLRAREFNGFTLATIHNEHFFVKLLDDIRASIDGGYFDEFR
DEALAHFYGNGERRPGL
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgacgatcagccttcttgaacatccgttgggcgcacagcccggacagcccggcgaccgc
agcgccttccatttcgaaacgatcacccgcctgccatccacggccagcgggcttgggcga
gacggtgcccgatacggccgcaccggcatcattcacacgccccacggcgatattcgcacg
cctgccttcgtgccggtgggcacgcaagccgcgatgaaggccgtgttgcccgagcagatg
aaggatctaggcgcacagtgcctgctggccaacgccttccacctgttcgagcgcccgggc
gaggacgtgctggacgcggccggcgggctggcgaacttcatgaactgggatgggcccacg
ttcaccgattctggcggtttccaagtgatgtcgctgggcgtcggcttcaagaagacgctg
gcaatggacgtgaccggcatgaagtcggacgacatcatcgccaagggcaaggagcgcatg
gcctgggtggacgaggacggcgtgacgttcaagtcgcctttgaatggtgacgcacatcgg
ttctccgctgagatttcgatgggcatccagcacaaaatcggcgcagacatcatgttcgcg
ttcgacgaactcaccacgctgatgaacacccgctcctatcaggaggactcggtggagcgc
accttccgctgggcccgccgatgcgtggacgagcaccagcggctgacggctgagcggctg
ggcaagccctatcaggcgctgtatggcgtggtgcagggcgcgaattacgaggatctacgc
cggcgcgcggcctcgcagatcgcctcgctggacttcgacggcgtgggaatcggcggcgca
atcgagaagcgcatcattggagacacctgcgcgtggatctgcgacgcgatgccggaaaac
cgcccgcgccatgtgctgggcatcgcctccgtggacgatattttcgcctgcgtggagaac
ggcggcgacaccttcgactgcgtggcccccgcgcgctgcgcccgcaacggcgcgatctac
acgcgcgccggccggtacaacatcaagcgtgcccagcataagttcgatttcgggccgctg
gaggagggatgcgactgctacacatgccagcattattcgcgcgcgtacgtcgaccacctg
ctgcgcgcccgcgagttcaacgggtttacgttggccacgatccacaacgagcatttcttc
gtgaagctgctagacgacatccgcgcctcgatcgacggcggatactttgatgagttccgc
gacgaagcgctggcccacttctacggcaacggcgagcgccggccagggttgtga

DBGET integrated database retrieval system