KEGG   Bifidobacterium longum subsp. longum JDM301: BLJ_0082Help
Entry
BLJ_0082          CDS       T01240                                 

Definition
(GenBank) AAA+ superfamily ATPase
  KO
K07133  
uncharacterized protein
Organism
bll  Bifidobacterium longum subsp. longum JDM301
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(109513..110244)
Genome map
AA seq 243 aa AA seqDB search
MPLNLFFSNYIDTYIERDVSEYLDVRNLAEFRRFLTLCALSSGALINYTNIANELGVSPR
TVKAWMSILESSYIAFHLMPFYTNARKQVVKTPKLYFYDTGLLCHLLGIRTVEALVAHPK
FGDIFENLIIAETMKQHLNANQEPQLFFYRDASKVEVDLLDFTDPNNRMLIEIKSGQTYH
DRFARHLTLIGNILGIPCEQQYVTSRVEHSYVSQGIRVTSAPRLARRPTVKSRRRAVGIL
CNQ
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgccgctcaatctgttcttctcgaactacatcgacacttatatcgaacgtgatgtttcc
gaatatcttgatgtacgcaatttggctgaattccgccgattcttgactctttgcgcactc
agttccggagcactcataaactacaccaacatcgccaatgaacttggtgtaagtccgcga
accgtaaaggcatggatgtcgattctggaatcaagttacatcgcattccatctcatgccg
ttctacacgaacgcacgcaaacaggtggtcaaaacgccgaaactctatttctatgacact
ggcttgctgtgtcatctcttgggcattcggacggtcgaagcactggttgcgcatcccaag
ttcggcgatatatttgaaaacctcatcattgcggaaaccatgaaacagcatttgaacgcc
aatcaggagccgcaattattcttctaccgcgatgccagcaaggtcgaggtggatttgttg
gatttcaccgatcccaacaaccgtatgctcatagaaatcaaatccggacaaacctatcat
gaccggttcgcccgccatctcactttaattggcaatattctcggtataccgtgtgagcaa
cagtacgtaaccagtcgggttgagcatagttatgtctcacaaggaatccgcgtcacctcc
gcccctcgattggctagaaggccgacggtaaagagccgccgcagagcagtaggaattctg
tgcaatcagtga

DBGET integrated database retrieval system