KEGG   Bifidobacterium longum subsp. longum JDM301: BLJ_0086Help
Entry
BLJ_0086          CDS       T01240                                 

Definition
(GenBank) major facilitator superfamily MFS_1
Organism
bll  Bifidobacterium longum subsp. longum JDM301
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 MFS_2 Sugar_tr
Motif
Other DBs
NCBI-ProteinID: ADG99580
UniProt: D6ZXD4
Position
113534..114709
Genome map
AA seq 391 aa AA seqDB search
MRGQQRAIRVLFVAQGLSLAAMSVDLTVTALVGSELAPFAWMATIPIALIALGTVFANTF
VNRLIARIGHKHVFEAGAVIAICGGISSFCAVWFHNFPLLCVGTFAVGIYQAASNYYRYA
AADLNPGKKDRAVSVVLSAGVIAAIVGPLLATWAEGLFPVHYAGSYLIVSVLGILALATV
AMFPADQQIGSTRQPVGSAQKVGLLDLLRRPRFLLGICLGFTACCAMTMIMSGAPLVMEH
VLRESDGTRMQAMQLHMLGMYLPMALIPLLNSKKRSHTVFVSLALGLGLVSCLLGLGQNA
PLVAMALLGIAVAWALGYNEGTVLLVSSYSADEVASARGKGEFFLVCGQVIGSLLAGSVI
EFLGWRTMLAILTLLFVLTSGIAINSRKAIA
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgcgtggtcaacagcgcgccattagggttttgtttgttgcgcagggactgagtctcgct
gcgatgagcgttgacctaacggtcactgcgctcgtgggcagcgagctggccccgttcgcg
tggatggcgacgataccgatcgccttgatcgcgttggggacggtgttcgccaataccttc
gtcaatcgcctcatcgcccgcatcgggcacaagcatgtgttcgaggccggggcggtcatc
gccatatgcggcggaatcagctcgttctgcgcggtatggttccacaatttcccgcttctg
tgcgtcggcacgtttgcggtcggcatctatcaggcggcctccaactactaccgttacgcg
gcggccgatctcaaccccggcaagaaggaccgggccgtgtccgtggtgctgtccgccggc
gtcatcgccgcgatcgtcggcccgttgctggcgacgtgggccgagggactgttccccgtc
cactacgcaggctcctatctcatcgtaagcgtcctcggcatactcgctctggcgacggtg
gcgatgttcccggcagaccagcagatcggaagcacgcggcagcccgttggttcggcgcag
aaggtcggcctgcttgatctgctgcgccgtcctcgctttctgctcggcatctgcctggga
ttcaccgcgtgctgcgccatgaccatgatcatgtccggcgccccgctggtgatggaacat
gtgctgcgcgaatccgacggcacgcgcatgcaggccatgcaactgcacatgctcggcatg
tatctgcccatggcattgattccactgctcaactccaagaaacgctctcacacggtcttt
gtatctcttgctctagggctaggtcttgtcagctgtctgttgggtctaggtcagaacgct
ccgctcgtcgcgatggcattgctgggcatcgccgtcgcctgggcactcggctacaacgag
ggcacggtgttgctggtgagctcgtattccgccgacgaagtggcgtcggccagaggcaag
ggcgagttcttcctcgtatgcggacaggtcatcggcagtctgttggccggctccgtcatc
gaattcctcggatggcggaccatgctggcgatcctgactctgctgtttgtgctgacatcc
ggtatcgccatcaacagtcgaaaggctatcgcctag

DBGET integrated database retrieval system