KEGG   Bifidobacterium longum subsp. longum JDM301: BLJ_0095Help
Entry
BLJ_0095          CDS       T01240                                 

Definition
(GenBank) inner-membrane translocator
  KO
K01998  
branched-chain amino acid transport system permease protein
Organism
bll  Bifidobacterium longum subsp. longum JDM301
Pathway
ABC transporters
Quorum sensing
Module
Branched-chain amino acid transport system
Brite
KEGG Orthology (KO) [BR:bll00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    BLJ_0095
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    BLJ_0095
Transporters [BR:bll02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Branched-chain amino acid transporter [MD:M00237] [OT]
    BLJ_0095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
124086..125069
Genome map
AA seq 327 aa AA seqDB search
MDFMTIISNAAGELIAPTTAAYVLAAIGLNIHFGMTGLMNMGQAGFMLLGAYGFAITQSM
GCNLFASVCAALALAVIYALLLGIPTLKLGPDYLAMVTLAAAEIIRIVGRSTAMTNFTGG
SAGISPQDFTEKFEALSPLPDGSTTFLLWTYSNNIANSWWLRIVAWILVAIAAFLCWRWF
HSPWGRMLKGIREDENAIRSLGKPVTKYKMESLILGGLFGAMAGIIFVLPRSVQPDSLGR
TVTFYVWTILLLGGAATILGPVLGSCVLWVLLTFVKEVMRNTVPETLISSNQIEALGWVI
VGVALMCLVIFRPQGLLGDRKELAFHA
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggacttcatgacaatcatctccaacgcggcgggcgagctgatcgcccccaccacggcg
gcatacgttctcgccgccatcggtttgaacattcacttcggcatgaccggcctgatgaac
atgggccaggcgggcttcatgctcctcggcgcctacggattcgccatcacgcagtcgatg
ggctgcaacctgttcgcctcggtctgtgcggcgctcgcgctcgccgtcatctacgcgctg
ctgctcggcattccgacgctgaagcttgggcccgactatctggccatggtcacgttggcg
gccgcggaaatcatccgcatcgtcggccgttccacagccatgacgaacttcaccggcggt
tccgcgggcatctcgccgcaggatttcactgaaaagttcgaagcgctttccccactgccc
gacggctcgaccacgttcctgctgtggacgtacagcaacaacatcgcgaattcctggtgg
ctgcgtatcgtggcttggattttggttgcgatcgctgcgttcctgtgctggcgatggttc
cactcgccgtggggccgtatgcttaagggcattcgtgaggatgagaatgcgattcgttcg
cttggcaagccggttacgaaatacaagatggaatcgttgattttgggcggattgttcggt
gcgatggccggcatcatcttcgtcctgccgcgctccgtacagcccgattcgctcggccgt
acagttacgttctacgtgtggacgattctgctgctgggcggcgcggccacgattctcggt
cctgtgctcggctcctgcgtgctgtgggtgctgctcaccttcgtcaaggaggttatgcgc
aacaccgttcccgaaaccctgatctcctccaatcagatcgaagccctcggctgggtgatc
gtcggcgtggcgctgatgtgtctggtgatattcagaccccaaggcctgttgggcgaccga
aaggagttggctttccatgcctga

DBGET integrated database retrieval system