KEGG   Bifidobacterium longum subsp. longum JDM301: BLJ_0098Help
Entry
BLJ_0098          CDS       T01240                                 

Definition
(GenBank) Extracellular ligand-binding receptor
  KO
K01999  branched-chain amino acid transport system substrate-binding protein
Organism
bll  Bifidobacterium longum subsp. longum JDM301
Pathway
bll02010  ABC transporters
bll02024  Quorum sensing
Module
bll_M00237  Branched-chain amino acid transport system
Brite
KEGG Orthology (KO) [BR:bll00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    BLJ_0098
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    BLJ_0098
Transporters [BR:bll02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Branched-chain amino acid transporter [MD:M00237] [OT]
    BLJ_0098
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peripla_BP_6 ANF_receptor Peripla_BP_5 Peripla_BP_4
Motif
Other DBs
NCBI-ProteinID: ADG99591
UniProt: D6ZXE5
Position
127396..128700
Genome map
AA seq 434 aa AA seqDB search
MVIHMKKTNMKGMKKLSITVTAVVAAAVMALAGCGSGSGSGSSSSDASDSGAKTTKFVLG
GLWPETGSLAYLAPPELAAEKLAVKDINDAGGVLDSKVTTVDADTSDADHADQNTSAAQS
VLSKNPSFIIGPASSSVVKNTYKSITSQNIPMLSMGATSAGFSGLSDYFFRTVAPDTVQG
AVMGNLIAQDGVQKLAIAVFNDEYGTGLRDTVVKTASAAGVDIVYGEKDTFDPTETNFSS
IATAIKASNPDATLVIAFDQTKPLLKALASAGVDTKKLYFVDGNTSDYSSELDAGLLEGS
KGTIPGVNPSDDFVKRLESTGVDLKNTTTYGAETYDGIILAALAAQKGGSADGKTIQANM
AAVSGADGGEKCDSYKACLALLKDGKDIQYQGQTGIGPFNKNNDPSSANIGVYTFDKDNK
PVFDHTQSGDVPND
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atggtgattcatatgaagaagacaaacatgaagggcatgaaaaagctgtccatcaccgtc
accgcagtagtggccgccgcggtcatggcgctcgccggctgtggttctggctccggttcc
ggaagctccagctccgacgcatccgattccggtgccaaaaccaccaagttcgtgcttggc
ggtctgtggccggaaacaggatccctggcctatctggcaccgcctgaactggccgccgaa
aagctggcagtcaaagacatcaatgacgccggtggcgtacttgacagcaaggtcaccacc
gtggacgccgatacgtctgatgcggatcatgccgaccagaacacgtcggctgcccagtcg
gtgttgagcaagaatccgtcgttcattattggccccgcttccagctccgtggtgaagaac
acatacaagtccattacttcgcagaacattccgatgctgtcgatgggtgccacttcggcc
ggcttctccggtctgtccgactacttcttccgcacggtcgctcctgatactgtgcagggt
gcggttatgggtaatctgatcgcccaggatggcgtgcagaagcttgctattgcagtcttc
aacgacgaatacggcaccggtctgcgcgacacagtcgtcaaaaccgcttccgcggcgggc
gtcgacatcgtctacggcgaaaaggacaccttcgatccgaccgagacgaacttctcctca
atcgccaccgccatcaaggcgtccaaccccgacgcgacgctcgtcatcgccttcgaccag
accaagccgttgctcaaagcgctcgcttccgccggggttgacaccaagaaactgtacttc
gtggatggcaacacctccgactattcgagcgaactcgacgcaggcctgctggaaggctcg
aaaggcaccattcctggcgtcaacccgtccgacgacttcgtcaagcgtcttgaatccacc
ggtgtggatctgaaaaacaccaccacctatggcgctgaaacatacgacggcatcatcctc
gcagccctcgccgcgcagaagggcggcagcgctgacggcaagaccattcaagccaacatg
gcggccgtctccggtgctgacggcggcgagaagtgcgattcctacaaggcctgcctcgcc
ctgctgaaggatggcaaggatatccagtatcagggccagaccggcattggaccgttcaac
aagaacaatgatccgagttctgcgaatatcggcgtctacacctttgacaaagacaacaag
ccggtctttgaccacacgcagtctggtgacgttccgaacgactga

DBGET integrated database retrieval system