KEGG   Bifidobacterium longum subsp. longum JDM301: BLJ_0099Help
Entry
BLJ_0099          CDS       T01240                                 

Definition
(GenBank) regulatory protein, LacI
  KO
K03484  
LacI family transcriptional regulator, sucrose operon repressor
Organism
bll  Bifidobacterium longum subsp. longum JDM301
Brite
Transcription factors [BR:bll03000]
 Prokaryotic Type
  Helix-turn-helix
   LacI family
    BLJ_0099
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
129062..130147
Genome map
AA seq 361 aa AA seqDB search
MVGMRDVAKKAGVSLSTVSLVVNGNGYVSDDMRERVRKAMQLLNYVPNELARNLYHDRTN
LVGVIVPTIRHPFFATFTAHLQHALAAQGLRTMLCSTADEAEGEIQYVDMLRRHMMDGIV
MCAHTSHPGDYWTSIHRPIVAFDRVLGDGISSIGSDHEQGGRLIAQMLIRNGTKHVVMIG
GPRDQFFDLAARGEVEEGPFDLGKTTFPTVRYYLTLEQELTSAGVKYEYVEAGEVMDFAG
YHRAVSNALDKVTTDGVDAVVSSDIGASFCVREALSRGISIPDELQIVAYDGTYLTDLAG
MKLTAVAQDFSAIAQSAADHIVQAIANEEVAAANASRKNIPKPFEPNVLIPMTLVPGDTT
H
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggtcggcatgcgcgatgtggcgaagaaggccggggtgtctctgagcaccgtctcgctg
gtggtgaacggcaacgggtacgtgtctgatgacatgcgcgaacgtgtgcgcaaagccatg
caactgctcaattatgtgccgaacgagcttgcccgcaatctgtatcatgatcgcacgaat
ctggtcggcgtcatcgtgcccaccatccgccacccgttctttgcaacgtttaccgcacat
ctgcagcatgcgctcgccgcgcaaggattacgcactatgctgtgctctactgcagatgag
gcggagggcgaaatccagtatgtcgacatgttgcgtcggcacatgatggacggcatcgtc
atgtgtgcgcacacttcgcatcccggcgattattggacgtcgattcatcgcccgatcgtc
gcgttcgaccgtgtgcttggagacggtatttcgtcgatcggatccgaccacgagcagggt
gggcgattgattgcgcagatgctgatccgcaatggtaccaaacatgtggtgatgattggc
ggtccgcgagatcaattcttcgatttggctgcgcgcggagaagtcgaggaaggaccgttc
gatttgggaaagaccacgttcccgacggtgcgctattacctcacgttggaacaggaattg
acctccgcaggcgtgaaatacgagtacgttgaagctggcgaagtgatggattttgccggc
tatcatcgtgcggtcagcaatgcgctcgacaaggtgacgaccgacggcgtcgatgccgtg
gtcagttccgatattggcgcgtcgttctgcgtgcgcgaagcgttgagccgcggaatttcc
attcctgacgagctgcagatcgttgcctacgatggcacgtatttaaccgatttggccggc
atgaagctgaccgcggtcgcgcaggatttctcggcgatcgcacagtcggcagccgaccat
attgtgcaggcgattgccaatgaggaagtggccgcagctaacgcttcacgcaagaatatt
cccaagccgttcgagccgaacgtgcttattcccatgacgctggtgccaggcgataccacg
cattga

DBGET integrated database retrieval system