KEGG   Bifidobacterium longum subsp. longum JDM301: BLJ_0101Help
Entry
BLJ_0101          CDS       T01240                                 

Definition
(GenBank) major facilitator superfamily MFS_1
Organism
bll  Bifidobacterium longum subsp. longum JDM301
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 MFS_2
Motif
Other DBs
NCBI-ProteinID: ADG99594
UniProt: D6ZXE8
Position
132103..133737
Genome map
AA seq 544 aa AA seqDB search
MLEPYVRPGIDDRPDLDKALSPEDKAAVARLAIKDRRRPPEASADQPEAQTVRLAAAGSS
AAAAAAASVDTPAPDMSSAYLDMRDPMVAADGQRPTTGQVSRLNWGFFAASILVGAPWIA
LNTIAMPNAVARLFGYDTAALQVTINPATGRPLPVATDLAMPLAVLVIVGVVASMFAMPL
ISALSDRTRTPLGRRTPWMVAGGVLCALLTLLLGQNIGIVVLCIFWALMQFAYAMLSAPL
ASAISERVPDKFRPRIERWHGIGVMLGQALGVCMGAFGVMFDSFTPFTYTAVLFAVSGIL
SVLILPKEPSSIEQPRQLFNSDQVLDQLRPPAHAPAFARVFTARTCMMTGVGLTGVFLWY
LVRFWVYGKAVVFTSAPLTLPAGFLIAGMAAATLVGAALASWAAGPISESIEEKNIPTTR
VVAGACLLYAIGLGLAWGLGVWSTGTARENGMLLFALISGFAFGIYDSLGLELVMDSLPD
PRRAGHDLGIYALANSAGLALAAIIGALLVNAFEHSFGYYLLFPSAIVMVLLAGIVTLTA
ESAQ
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgttggaaccgtatgtgcgcccaggcattgacgatcgcccggatctcgataaggccctg
agccccgaagacaaggcagccgtagcccgactggccatcaaggaccgtcgtcgcccgccc
gaggcatccgccgaccagcccgaggcccaaactgtgcgattggccgccgccggctcctcg
gccgccgccgcagccgccgccagcgtggacaccccggcaccggacatgtcatccgcctac
ctcgatatgcgcgaccctatggtcgccgccgacggtcaacggcccaccacgggccaggta
tcccgtctcaactgggggttcttcgccgcttccattctggtcggcgcaccttggatagca
ttgaataccatcgccatgcccaacgcggtggctcgtctgttcggctacgacaccgccgcg
ctgcaagtcaccatcaatccggccaccggccgtccactgcccgtcgccactgatctggcg
atgcctttggccgtgttggtgattgtcggcgtcgtagcctccatgtttgctatgccgctg
atttcggcgctttccgaccgcacgcgcacgccattgggccgtcgtaccccgtggatggtg
gccggcggtgtgctgtgtgcgctgcttacgttgcttctgggacagaatatcggcatcgtg
gtgctttgcatcttctgggcgctgatgcagttcgcctacgcgatgctctccgcgccgttg
gccagcgctatcagcgagcgagtgccggataagttccgcccgcgcatcgaacgctggcat
ggcatcggcgtgatgctcggccaagcgcttggtgtgtgcatgggcgcatttggcgtgatg
ttcgactcgttcaccccattcacctataccgcggtactgttcgcggtctccggcattctt
tcggtattgatcctgcccaaggagccttccagcatcgaacagccgcgccagctctttaat
agcgaccaggtactcgaccaactgcgtccgccggctcatgcgcctgcgttcgctcgcgta
ttcactgcccgcacctgcatgatgaccggcgtcgggctgaccggcgtcttcctgtggtac
ctcgtgcgcttctgggtatacggcaaagccgtggtgttcacgtccgcgccgctgaccctt
ccggccggattcctcatcgccggcatggcggcggccacactggtcggcgctgcgctcgct
tcgtgggcggccggtccgatttccgaatcgattgaagaaaagaacattcccaccacgcgc
gtggtggccggtgcctgcctgctgtatgcgattggcctggggctcgcatggggccttggc
gtctggtccaccggcaccgcccgtgaaaacggcatgctgctgtttgcgctgatctccgga
ttcgctttcggcatttacgattcgctcggccttgaactggtgatggactctttgcccgac
ccgcgccgagccggccacgacctcggcatttatgcgctcgccaattcggccggtctggcg
ctcgccgccatcatcggcgcgctactggtgaacgccttcgagcacagcttcggctattac
ctgctcttcccgtccgccatcgtcatggtgctgctggccggaatcgtcaccctcaccgcc
gagtccgcgcaatga

DBGET integrated database retrieval system