KEGG   Bifidobacterium longum subsp. longum JDM301: BLJ_0102Help
Entry
BLJ_0102          CDS       T01240                                 

Definition
(GenBank) major facilitator superfamily MFS_1
Organism
bll  Bifidobacterium longum subsp. longum JDM301
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sugar_tr MFS_1 UPF0182
Motif
Other DBs
NCBI-ProteinID: ADG99595
UniProt: D6ZXE9
Position
134226..135593
Genome map
AA seq 455 aa AA seqDB search
MTAAVEETGLGQAAGKAATLVRDSVKTVIAASMVGTAIEFYDFYAYGTAAANYFPHIFFS
AKDNPTVALLMSLLTFAIAFIARPLGSLIFGHFGDRMGRKTTLVVSLMTMGVGTFLIGCL
PTYDQVGVGAVAILCLLRFIQGIGLGGEWSGAALVATENAPEDKRALYGSFPELGAPIGF
FLSNGTYFVLESFNNQDAMLAWGWRVPFLLSAILVIVGLVVRVHMEETPIFRMAQEQKKV
VKSPLTEVFRKSWRQVLQATFLVAVTYTLFYTLATWSLAWGTKEQGEGGGGLGFTNQEYL
LMLMISICVFALFIVLSCLYADKIGRKRVLTFSSCALVVFAVLFPFLLDGGLVGPKNFFA
NMVFLCVGFALMGIAFGPIGAFLPELFDANVRYSGSGIGYNLAAIVGAAFVPTIATWLSS
HWGVHSVGLYLAVMAVCCLVSVLTCRETKDADFTK
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgactgcagcagtcgaagagactggcttagggcaggcggcaggtaaagccgctaccttg
gtacgcgattcggtcaagaccgtgatcgccgcatcgatggtcggtaccgccatcgaattc
tatgacttctacgcctacggcaccgccgcggcaaactacttcccgcacatcttcttctcc
gcgaaggacaaccccaccgtcgcactgctgatgagcttgctgaccttcgccatcgccttc
atcgcccgcccgctgggctcgctgatcttcggccacttcggtgaccgcatgggccgcaag
accacgctggtcgtcagcctgatgaccatgggtgtcggcaccttcctgattggctgcctg
cccacctacgatcaggtcggcgttggcgcagtcgccatcctctgcctgctgcgcttcatc
cagggcatcggcctgggcggcgaatggtccggcgcggcactggtcgccaccgagaacgcg
cctgaagacaagcgcgcactgtacggctccttcccggagctcggtgccccgatcggcttc
ttcctgtccaacggcacctacttcgtgctcgaatccttcaacaatcaggacgcgatgctg
gcttggggctggcgtgtgccgttcctgctgtccgccatcctggtgatcgtcggcctcgtg
gttcgcgttcacatggaggagaccccgatcttccgtatggctcaggagcagaagaaggtc
gtcaagtccccgctgaccgaggtcttccgcaagtcttggcgtcaggtgctgcaggccacc
ttcctcgtggccgtgacctacacgctgttctacacgctcgccacctggtccctcgcttgg
ggcaccaaggagcagggcgaaggcggcggaggccttggcttcaccaaccaggaatacctg
ctcatgctcatgatctccatctgcgtgttcgccctgttcatcgtgctgtcctgcctgtac
gcggacaagatcggccgcaagcgcgtgctgaccttctcctcctgcgcactcgtcgtgttc
gccgtgctcttcccgttcctgctggacggtggtctggtcggcccgaagaacttcttcgcc
aacatggtgttcctgtgcgtcggctttgccctgatgggcatcgccttcggcccgatcggc
gccttcctgcctgagctgttcgacgccaatgtgcgttactccggctccggcatcggctac
aatctggccgccatcgtcggcgcggctttcgtgccgaccatcgccacttggctgagctcc
cactggggcgtccactccgtgggcctctacctcgccgtgatggccgtgtgctgcctggtg
tcggtcctgacctgccgtgagacgaaggacgctgactttaccaagtga

DBGET integrated database retrieval system