KEGG   Bifidobacterium longum subsp. longum JDM301: BLJ_0103Help
Entry
BLJ_0103          CDS       T01240                                 

Definition
(GenBank) ketol-acid reductoisomerase
  KO
K00053  ketol-acid reductoisomerase [EC:1.1.1.86]
Organism
bll  Bifidobacterium longum subsp. longum JDM301
Pathway
bll00290  Valine, leucine and isoleucine biosynthesis
bll00770  Pantothenate and CoA biosynthesis
bll01100  Metabolic pathways
bll01110  Biosynthesis of secondary metabolites
bll01130  Biosynthesis of antibiotics
bll01210  2-Oxocarboxylic acid metabolism
bll01230  Biosynthesis of amino acids
Module
bll_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
bll_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:bll00001]
 Metabolism
  Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    BLJ_0103
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    BLJ_0103
Enzymes [BR:bll01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.86  ketol-acid reductoisomerase (NADP+)
     BLJ_0103
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IlvN IlvC F420_oxidored NAD_binding_2 2-Hacid_dh_C Mur_ligase AdoHcyase_NAD CoA_binding ApbA Shikimate_DH Oxidored_nitro PDH GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: ADG99596
UniProt: D6ZXF0
Position
135817..136869
Genome map
AA seq 350 aa AA seqDB search
MAATIWYEKDADLSVFDGKKVAILGYGSQGHAHALNLRDSGVDVVVGLRPTSKSVEFAKE
QGLEVKPVGEAVAEADVVMILLPDQYQAKVYKEEVEPNLKPGAALAFAHGFNIHYGYIKP
SEDHPVFMVAPKGPGHIVRREYAAGRGVPVVVAVEQDPDGKTWPLCLAYAKALGALRAGA
IKTTFTEETETDLFGEQDVLMGGINHLCDLGFDVLTEAGYQPEIAYFEVFHELKMLVDLA
NEGGLNKARWSCSDTAQYGDYTSTVITDETKKRMQYQLKRIQDGSFAKEFMDDQAAGAPK
FKELQEEFSHPHLETVGPKLRAMFSWNNAEAKDKDEAESFNGKIARTQVQ
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atggcagcaactatctggtacgagaaggacgccgatctgtccgtgttcgatggcaagaag
gtcgccatcttgggctacggctctcagggtcacgctcacgcactgaacctgcgtgactcc
ggtgtcgacgtggtcgtcggcctgcgtccgacctccaagtctgtcgagttcgccaaggag
cagggtcttgaggtcaagccggttggcgaggccgtcgccgaggctgacgttgtgatgatc
cttctgcctgaccagtaccaggccaaggtctacaaggaagaggttgagccgaacctgaag
ccgggcgctgccctggcgttcgcccacggcttcaacatccactacggctacatcaagccg
tccgaggatcacccggtgttcatggtcgccccgaagggcccgggccacatcgttcgtcgt
gagtacgccgccggccgtggcgtcccggtcgtcgttgccgtcgagcaggacccggacggc
aagacctggccgttgtgcctggcttacgccaaggctctgggcgctctgcgtgcgggcgcc
atcaagaccaccttcaccgaggagaccgagaccgatctgttcggtgagcaggacgtcctc
atgggcggcatcaaccacctgtgcgacctcggcttcgacgtgctgaccgaggccggctac
cagccggagatcgcctacttcgaggtgttccacgagctgaagatgctggtcgacctggct
aacgagggtggcctgaacaaggctcgctggtcctgctccgacaccgctcagtacggcgac
tacacctccacggtcatcaccgacgagaccaagaagcgcatgcagtaccagctcaagcgc
attcaggacggctccttcgccaaggagttcatggacgaccaggccgctggcgccccgaag
ttcaaggagctgcaggaagagttctctcacccgcacctcgagaccgtcggcccgaagctg
cgcgccatgttctcctggaacaacgccgaggccaaggacaaggacgaggccgagtccttc
aacggcaagatcgcccgtacccaggttcagtga

DBGET integrated database retrieval system