KEGG   Bifidobacterium longum subsp. longum JDM301: BLJ_0107Help
Entry
BLJ_0107          CDS       T01240                                 

Definition
(GenBank) Uncharacterized membrane-associated protein
Organism
bll  Bifidobacterium longum subsp. longum JDM301
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MarR MarR_2 HTH_34 DUF4423 HTH_27 YgbB
Motif
Other DBs
NCBI-ProteinID: ADG99600
UniProt: D6ZXF4
Position
complement(139365..140393)
Genome map
AA seq 342 aa AA seqDB search
MDAEHYIRETLGLPCQITSWDGTASLPLFLTNGRTFSKLTIDNTSMLIASGEAHPFSITR
VTADASRLEQRTDLPIVFQFPRLSAYQRKALIQNHVPFIVPGTQLYIPSLGMVFTQRISS
RPLENAQDIEVRPFSPATQLVWLYLLYSNESKVQSDIARALQFTEAQVSVAVTLLEQLAF
VHRTKQGRSNSVELLTSRQTSRLDLLKSSWHLLKSPIFSKYTVTNRNRQMIADELIPAGE
FALSRRTQLATPKLRIYAVERHWLKQHNKELCIIDPALEKVPDNAYILELWRYDPRLLAQ
YTQEDYLADPISTALTLGEIADERLEDAIQESIRNTFSGATI
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggatgccgagcattacattcgcgagacacttggcctgccctgccaaatcacttcttgg
gatggcactgcatcactgccgctatttctgaccaacggacggacattcagcaaactcacc
atcgacaacacgagcatgctaatcgcgagcggagaggctcacccattcagcatcacacgc
gtcaccgccgacgccagcaggcttgagcagcggacggatctgcccattgtctttcagttt
ccccggctttctgcataccagcgaaaagccctgattcagaatcacgttcctttcatcgtg
cccggtacccaactgtatatcccttcactgggcatggtgttcacccagcgcatctcctca
cggccgctggagaacgcacaggatatcgaggtgcgacccttctcccccgcaacacagctg
gtctggctgtatttgctctactccaacgagagcaaagtccaatcagatattgcccgagcg
cttcagtttaccgaagctcaggtcagcgttgccgtgacgctgttagaacagctggcattc
gtgcaccgcaccaagcaaggccgcagcaatagcgtcgaactactgacttcaaggcagacc
agccgacttgatttactgaaatcatcttggcatctcctgaagtcaccaatattcagcaaa
tataccgtcacgaatcgcaatcgccagatgattgccgacgagctgattccggccggcgaa
tttgctctttcgcgcaggacgcaactggccaccccaaaactgcgaatctatgccgttgaa
cgtcattggctcaagcagcacaacaaggaactatgcattatcgaccccgctttggaaaag
gtgccagataatgcatatattctggagctgtggaggtacgatccccgcctacttgctcaa
tatacgcaggaagactaccttgccgaccccatttccacggccctgactcttggcgagatt
gccgacgaacgtttggaagacgccatacaagaatccatccgcaatactttctcaggggcg
acaatatga

DBGET integrated database retrieval system