KEGG   Bifidobacterium longum subsp. longum JDM301: BLJ_0109Help
Entry
BLJ_0109          CDS       T01240                                 

Definition
(GenBank) regulatory protein, LacI
Organism
bll  Bifidobacterium longum subsp. longum JDM301
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peripla_BP_3 LacI Peripla_BP_4 Peripla_BP_1 HTH_Tnp_ISL3 TetR_N HTH_23 HTH_38 HTH_7 HTH_31
Motif
Other DBs
NCBI-ProteinID: ADG99602
UniProt: D6ZXF6
Position
complement(142574..143608)
Genome map
AA seq 344 aa AA seqDB search
MTKASIQAVAREAGVSVSTVSRTFAKPDLVLPETRDRVMAAAEKLDYSVSRSAAALKSGQ
SFRIALLASETIASWFNSNIFAGLDSALRPSGYDTVPYPMRNAAERHDFFADLPVRRNAD
AVIVSSFDIEPAEVERLKHMHVPIVGINIPSTDGFDAGVSIDDYAAIRSAIEHLIALGHR
HIAFVGSAPTETNMRYSAEARLQGVIDAAAAHPGIELTPLSIQRGLGESNAALNAVLNAS
PSITAFCFEDDEMAAPVLYRLRQYGRRVPQDISIIGFDDSTLSAAVGLTTLHQDPFAMGA
TAGHMVLDAIAGKSIEPAFVRPGTPLILRETTAPPAATAAPAQS
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaggcaagcattcaggcagtggcccgcgaggccggcgtttccgtatccacggtg
tcccggaccttcgccaagccggatctggtgcttcccgagactcgagaccgagtgatggcc
gcggccgaaaagctcgactactcagtctcacgctcggccgccgccctaaaatccggccaa
tcgttccgtatcgcactacttgccagcgagaccatcgccagttggttcaattcgaacatc
ttcgccggtcttgactcggcgctgcgcccctccggctacgacactgtgccctaccccatg
cgcaacgccgccgagcgccacgacttctttgcggatttgcccgtgcggcgcaatgcggat
gcggtgattgtcagctccttcgacatcgaaccggctgaggtggagcgactgaagcatatg
cacgtgccgattgtcggcatcaacatcccctccaccgatgggttcgacgcaggcgtgagc
attgatgattacgccgccatacgttcggctatcgagcacctgattgcactcggccaccgg
catatcgcgttcgtcggcagcgcaccgaccgaaaccaatatgcgctacagtgccgaggct
cgcttgcagggcgtcatcgatgccgctgccgcccatccggggatcgagctaacgcccctg
agcattcaacgcggtcttggcgaaagcaacgcggcattgaacgccgtactgaacgcctcc
cccagcatcaccgccttctgttttgaggatgatgaaatggccgcgcccgtgctgtatcgc
ctgcgtcaatacgggcggcgggtacctcaggacatttccatcatcggcttcgacgattcc
accctgtccgccgccgtgggactgaccacgctgcatcaggacccgttcgcaatgggcgcg
actgccgggcacatggtattggatgccattgccggcaagtcaatcgaaccggcattcgta
cggccgggcactccgctaatactgcgcgaaaccaccgcgccgcctgccgcgacagcagcg
cccgcgcagtcgtga

DBGET integrated database retrieval system