KEGG   Bifidobacterium longum subsp. longum JDM301: BLJ_0121Help
Entry
BLJ_0121          CDS       T01240                                 

Definition
(GenBank) hypothetical protein
Organism
bll  Bifidobacterium longum subsp. longum JDM301
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADG99614
UniProt: D6ZXG7
Position
complement(157535..157951)
Genome map
AA seq 138 aa AA seqDB search
MTGGRYALPAGIENSVRSVTHSRFGASAWKSRSTGFFGALASSPLYEPYRFALLNGGAGP
CGVISRMTRLADTLTPMLSSSRWTRLYPQRRLPFSNASRTSSAPVSPPSPAVGGFSPDVS
VTCASLDPASTGSIPLPG
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgaccggcggcaggtacgccttgcccgcgggaatcgagaactcggtcaggtccgtgacc
cacagccggttcggcgcctcggcgtggaagtcgcggtccaccgggttcttcggggccttg
gcgagctcgcccttgtacgagccgtaccgcttcgcgctcttgaacggcggcgccggacca
tgcggggtcatcagccgcatgacccgtctggcggataccctgacgcccatgctttccagc
tccagatggacgcgcttgtacccgcagcggcgtctgccgttctcgaacgcctcgcgcacg
agctccgcgccggtttcccccccctccccggccgtcgggggcttctctccagatgtctcc
gtcacgtgcgcctccttggacccggcgagcaccggcagcatccccctgccgggatag

DBGET integrated database retrieval system