KEGG   Bifidobacterium longum subsp. longum JDM301: BLJ_0122Help
Entry
BLJ_0122          CDS       T01240                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
bll  Bifidobacterium longum subsp. longum JDM301
Pathway
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bll00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BLJ_0122
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BLJ_0122
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BLJ_0122
Enzymes [BR:bll01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     BLJ_0122
Exosome [BR:bll04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BLJ_0122
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
159087..160832
Genome map
AA seq 581 aa AA seqDB search
MQVRNGSAKLEGVTTTDVAKRVRPEECGPDGADDTAWKEGRTIGNHKALTSVVAAVASIA
TLGALAAPAFAVDAANGTYSPNGKSVAELAKHGAGKLVANPNPGKLTPVTDSSASGSAWA
TGTKTYNNAVDVDIYGNPQLNLFELAKAAGKATGNVSTAEIQDATPAVLESHSTERACYG
PQGKTDGTSNNASKQCLANQLKENGGIGSISEQLLDTRADVTIGGGSKYFRQTVQGGEYK
GKTVWEQAKDMGFQTVENDPAAMNALQYKDGQPVLALMSDGNMPTKFNPSKATAKDPAKD
AKPTVCAPNDAWLGNRGASLKDMTKKALDLLNANPNGQKNGFLLQVEGASIDKQDHAANA
CGQIGETDDFDQAIAYAIKNVDLTNTLVIVTADHAHTSQVLNAQPAYALSTVLKSADGNN
MVVSYGTAQEASTDAEGGYNGGDMEHTGTQLRIAASGPGAQRVIGLTDQTDNFYTIAGAL
GLATFPDEQNALSKDGTVKVARTQAGKVATVAIQAPAAGSADKKPGADKNGVIASGKVPD
DSAVSGPLGATGTAVMAIAIAAVMLVAIAMLIKAARNARNN
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtgcggaacggttccgcgaagctggaaggcgtaacgacgacggacgtggccaaa
cgggtgcggccggaggagtgcgggccggacggcgcagatgacactgcatggaaggaagga
agaacaataggcaatcacaaggctttgacgagcgtcgtcgcggcggtcgcctccatcgcg
acgctcggcgcgctcgccgctccggcgtttgctgtcgatgccgcaaacggcacctacagc
cccaacggcaagtcggtcgccgagctcgccaagcacggcgccggcaagctggtcgccaac
cccaacccgggcaagctcacccccgtcaccgattcctccgcgtccggttccgcatgggcg
accggcaccaagacctacaacaacgccgtggatgtcgacatctacggcaacccgcagctg
aatctcttcgagcttgccaaggccgccggcaaggccaccggcaacgtgtccaccgcggaa
atccaggacgccaccccggccgtgctggaatcgcactccaccgagcgtgcctgctacggc
ccgcagggcaagaccgacggcacttccaacaacgcctccaagcagtgcctcgccaaccag
ctcaaggagaacggcggcatcggctccatctccgagcagctgctcgacacccgcgccgat
gtgaccatcggcggtggttccaagtacttccgccagaccgtgcagggcggcgaatacaag
ggcaagaccgtgtgggaacaggccaaggacatgggcttccagaccgtcgagaacgacccg
gccgcgatgaacgccctgcagtacaaggatggccagccggtgctcgccctgatgagcgac
ggcaacatgccgaccaagttcaacccgtccaaggccaccgccaaggatccggccaaggac
gccaagccgaccgtgtgcgccccgaatgacgcctggctcggcaaccgtggcgcctcgctc
aaggacatgaccaagaaggcgctcgacctgctcaacgccaacccgaacggtcagaagaac
ggcttcctcctgcaggtcgaaggcgcttcgatcgataagcaggaccacgccgccaacgcc
tgcggccagatcggcgagaccgacgacttcgaccaggccatcgcctacgccatcaagaac
gtggacctcacgaacacgctggtgatcgtcaccgccgatcatgcgcacacctcccaggtc
ctcaacgcccagccggcctacgcgctgtccactgtgctcaagtccgccgacggcaacaac
atggtcgtctcctacggcaccgcccaggaagcctccaccgacgccgaaggcggctacaac
ggcggcgacatggagcacaccggcacccagctgcgcatcgccgcttccggccccggcgcc
cagcgcgtcatcggcctgactgatcagaccgataacttctacaccatcgccggcgccctg
ggcctggccaccttccccgacgagcagaacgcgctctccaaggacggcaccgtgaaggtc
gcccgtacgcaggccggcaaggtcgcgaccgtcgccatccaggcgccggccgccggctcc
gccgacaagaagccgggcgccgacaagaacggcgtgatcgcttcgggcaaggtgccggac
gattccgcggtctccggtccgttgggcgccaccggtaccgccgttatggccatcgccatc
gcggctgtgatgctggttgcgatcgcgatgctcatcaaggccgcgcgtaacgccaggaac
aactga

  All links  
No link information was found.   
DBGET integrated database retrieval system