KEGG   Bifidobacterium longum subsp. longum JDM301: BLJ_0123Help
Entry
BLJ_0123          CDS       T01240                                 

Gene name
dnaK
Definition
(GenBank) chaperone protein DnaK
  KO
K04043  molecular chaperone DnaK
Organism
bll  Bifidobacterium longum subsp. longum JDM301
Pathway
bll03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:bll00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    BLJ_0123 (dnaK)
Messenger RNA biogenesis [BR:bll03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Chaperones
     BLJ_0123 (dnaK)
Chaperones and folding catalysts [BR:bll03110]
 Heat shock proteins
  HSP70 / DNAK
   BLJ_0123 (dnaK)
Mitochondrial biogenesis [BR:bll03029]
 Mitochondrial protein import machinery
  Inner mambrane
   MINOS/MitOS complex
    BLJ_0123 (dnaK)
  Matrix
   MMC/PAM proteins
    BLJ_0123 (dnaK)
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Proteins involved in Fe-S cluster biogenesis
    BLJ_0123 (dnaK)
Exosome [BR:bll04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   BLJ_0123 (dnaK)
  Exosomal proteins of breast cancer cells
   BLJ_0123 (dnaK)
  Exosomal proteins of colorectal cancer cells
   BLJ_0123 (dnaK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP70 MreB_Mbl DUF3347 StbA VSG_B
Motif
Other DBs
NCBI-ProteinID: ADG99616
UniProt: D6ZXH0
Position
161263..163158
Genome map
AA seq 631 aa AA seqDB search
MARAVGIDLGTTNSCIATLEGGEPTVIVNAEGARTTPSVVAFSKSGEILVGEVAKRQAVT
NVDRTISSVKRHMGTDWTVDIDGKKWTPQEISAQILMKLKRDAEAYLGEPVTDAVITCPA
YFNDAQRQATKDAGKIAGLNVLRIINEPTAAALAYGLEKGKEDERILVFDLGGGTFDVSL
LEIGKDDDGFSTIQVQATNGDNHLGGDDWDQKIIDWLVSEVKNKYGVDLSKDKIALQRLK
EAAEQAKKELSSSTSTSISMQYLAMTPDGTPVHLDETLTRAHFEEMTSDLLGRCRTPFNN
VLHDAGISVSDIDHVVLVGGSTRMPAVKDLVKELTGGKEANQSVNPDEVVAVGAAVQSGV
IKGDRKDVLLIDVTPLSLGIETKGGIMTKLIDRNTAIPTKRSEVFSTAEDNQPSVLIQVY
QGEREFARDNKPLGTFELTGIAPAPRGVPQIEVTFDIDANGIVHVSAKDKGTGKEQSMTI
TGGSGLPKDEIDRMVKEAEAHEAEDKQRKEDAETRNQAEAFAYSTEKLVNDNKDKLSDDI
VKEVTDKVNALKEALKGDDTEKVKTAQTELMTAAQKIGQVLYAQQGAEGAAAGAGAAGAA
GAGASAGSASGSDDDTVEAEVVDDDDDKDNK
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atggcacgcgcagttggtatcgatctgggaaccacgaattcctgcatcgcaactctcgaa
ggtggcgagcccaccgttatcgtcaacgctgaaggcgcgcgcaccacgccgtccgtggtg
gccttctccaagtccggcgagatccttgtcggcgaagtggccaagcgtcaggccgtgacc
aacgttgaccgcaccatctcctccgtcaagcgccacatgggcaccgactggaccgtcgac
atcgacggcaagaagtggaccccgcaggagatttccgcgcagatcctgatgaagctgaag
agggacgccgaggcctacctcggcgagcccgtcaccgacgccgtcatcacctgcccggca
tacttcaacgatgcccagcgtcaggccaccaaggacgccggcaagatcgccggcctgaac
gtcctgcgtatcatcaacgagccgaccgcagccgctctggcctacggccttgagaagggc
aaggaagacgagcgcatcctggtcttcgacctcggcggcggcaccttcgatgtctccctg
ctggagatcggcaaggatgacgacggcttctccaccattcaggttcaggccaccaacggc
gacaaccacctcggtggcgatgactgggatcagaagatcatcgattggctggtctccgaa
gtcaagaacaagtacggcgtcgacctgtccaaggacaagatcgcgctgcagcgcctgaag
gaagccgccgagcaggcgaagaaggaactctcctcctccacctccaccagcatttccatg
cagtacctggccatgacccccgacggcaccccggtgcacctggacgagaccctgacccgc
gcgcacttcgaggaaatgacctccgacctgctgggccgctgccgcacgccgttcaacaac
gtgctgcacgacgccggcatctccgtgagcgacatcgaccacgtggtgctcgtcggcggt
tccacccgtatgcccgccgtcaaggacctggtcaaggaactcaccggtggtaaggaagcg
aaccagtccgtgaacccggatgaggtcgtggcggtcggtgccgccgtgcagtccggcgtc
atcaagggcgaccgcaaggacgtcctgcttatcgacgtgaccccgctgtccctcggcatc
gaaaccaagggcggcatcatgaccaagctcatcgaccgcaacaccgccatcccgaccaag
cgctccgaggtcttctccaccgccgaagacaaccagccgtccgtgctgatccaggtctac
cagggcgagcgtgagttcgcacgcgacaacaagccgctgggcaccttcgaactgaccggc
atcgctccggctccgcgtggcgtcccgcagatcgaggtcaccttcgacatcgacgccaac
ggcatcgtgcacgtgtccgctaaggacaagggcaccggcaaggagcagtccatgaccatc
accggtggttccggcctgccgaaggacgagatcgaccgcatggtcaaggaagccgaggct
cacgaggctgaggacaagcagcgcaaggaagacgccgagacccgcaaccaggccgaggcc
ttcgcctactccaccgagaagctcgtcaacgacaacaaggacaagctctccgacgacatc
gtcaaggaagtcaccgacaaggtcaacgccctgaaggaggccctgaagggtgacgacacc
gagaaggtcaagaccgctcagaccgagctgatgaccgccgcccagaagatcggccaggtc
ctctacgcccagcagggtgccgagggtgccgcggctggtgccggtgcggctggcgctgcc
ggcgctggcgcttccgctggctccgcctccggttccgacgacgacaccgtcgaggccgag
gtcgtggacgacgatgacgacaaggacaacaagtga

DBGET integrated database retrieval system