KEGG   Bifidobacterium longum subsp. longum JDM301: BLJ_0128Help
Entry
BLJ_0128          CDS       T01240                                 

Definition
(GenBank) ABC-type sugar transport systems, permease component
  KO
K10118  raffinose/stachyose/melibiose transport system permease protein
Organism
bll  Bifidobacterium longum subsp. longum JDM301
Pathway
bll02010  ABC transporters
Module
bll_M00196  Raffinose/stachyose/melibiose transport system
Brite
KEGG Orthology (KO) [BR:bll00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    BLJ_0128
Transporters [BR:bll02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Raffinose/stachyose/melibiose transporter [MD:M00196] [OT]
    BLJ_0128
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 PHO4
Motif
Other DBs
NCBI-ProteinID: ADG99621
UniProt: D6ZXH5
Position
166662..167666
Genome map
AA seq 334 aa AA seqDB search
MTAIQEAVPAAAGAAQSRGGEVSNAAAAAGKRVRARKHSGASQNSWQSKLRPYLFIAPLV
ILSGVFIYYCIGFTVATSFTDWDGISSEMDFIGLKNYTKLLAPGSVFWTALMNNIIFMVV
TVVIQAGLGLLLAVILKERLRGSSFFKAIFFMPIAMAPVIIAAIFRIIMDPNVGAINEAL
RFLHLDFLAQSWLGDPHIALYSICAINIFEWMGFSMIIYYAGLMSISDDIYEAAKIDGCG
FWNTLFRITIPNLSGTTNTLILLGIVGSLKTFDIVIQTTGGGPGRSTEFLNTYLYKAGVQ
QFNGGLSAAIGVMVLIIAVMLSLIQLAFNKRANN
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgacggcaattcaggaagccgttcccgccgcagcgggggcagcgcaaagccgtggggga
gaggtgagcaacgcggctgcggcagccggcaaacgtgttcgtgcccgcaagcacagcggc
gcatcgcagaactcatggcaaagcaagctgcgcccctacctgttcatcgccccgctggtc
attctctccggcgtcttcatctactactgcatcggcttcaccgtggccacatccttcacc
gactgggacggcatctccagcgagatggacttcatcggcctgaagaactacaccaagctg
ctcgctcccggctccgtgttctggacggccttgatgaataacatcatcttcatggtcgtc
accgtggtcatccaggccgggctcggactgctgctcgcggtgatcctcaaggagcgcctg
cgcggttccagcttcttcaaggcgatcttcttcatgcccatcgccatggccccggtcatc
atcgccgccatcttccgcatcatcatggatccgaacgtcggtgccatcaacgaggccctg
cgcttcctgcacttggacttcctggcccaaagctggcttggcgatccgcacatcgccctc
tactcgatctgtgccatcaacatctttgaatggatgggcttctcgatgatcatctactac
gccggtctgatgtctatctccgatgacatctacgaagccgccaagatcgacggctgcgga
ttctggaacaccctcttccgcatcaccattccgaacctgtccggcaccaccaacacgctt
atcctgcttggcatcgtcggctcgctgaagaccttcgatatcgtcatccagaccacaggc
ggcggccctggccgttccaccgaattcctgaacacctacctgtacaaggccggcgtgcag
cagttcaacggcggtctgtccgcggccatcggcgtgatggtcctcatcatcgccgtgatg
ctctccctgattcaacttgccttcaacaagcgtgccaacaactaa

DBGET integrated database retrieval system