KEGG   Bifidobacterium longum subsp. longum JDM301: BLJ_0132Help
Entry
BLJ_0132          CDS       T01240                                 

Definition
(GenBank) periplasmic binding protein/LacI transcriptional regulator
Organism
bll  Bifidobacterium longum subsp. longum JDM301
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
172437..173465
Genome map
AA seq 342 aa AA seqDB search
MVASSRKATLHDVAKRAHVSVASVSNYLNDYPYMKPATRERIQQAIDELGYVTNQQARNL
RSGRTGLISLSLPDLNQIYFSELAEEMITRAREYGYRIIIESTGNDRQREIESAHAMASN
MTDGLILSPTAMRAEDVAELEGDYPLVVLGERIFNAPAPHVVMPNELGAQAATTHLLEAG
CRTVAVVGGTLDESVPSSRSMRTKGYLSAFAERGVTPDLNLIRECGEWTSAEGAQAVREM
YAQGIRPDGIFALNDLLAMGVISQLREMRVRVPESVRVVGFDDIDEAKYTIPSLTTVDPQ
RARIAEIAITSILDQVKTGARAPRRRIDVEYSLRYRASSPQV
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggttgcgagttcgcgcaaggcgacgctgcacgatgtggcgaaacgtgcgcacgtgtcc
gtggcatcagtgtccaattacctcaacgattacccctatatgaagccggccacgcgcgaa
cgtatccagcaggccattgacgagctgggctatgtgaccaaccagcaggctcgcaatttg
cgttccggccgcacaggactcatctcattgtctctgccggatttgaaccagatttacttt
tccgaactggccgaagagatgatcacgcgggcacgggaatatggataccgcatcatcatc
gaatcgaccggaaacgaccgccagcgcgagatcgagagcgcacatgccatggccagcaat
atgaccgacggacttattttgagccccacggccatgcgggcggaggatgtggccgagctc
gagggcgactacccgctggtagtgctgggcgagcgtatcttcaacgcacctgcgccgcac
gtggtgatgcccaatgaattgggtgcccaagccgctaccacgcatctgctggaggccgga
tgccgcaccgtcgccgtggtgggcggaacgttggacgaatccgtgccgtcctctcgttcg
atgcgaaccaaggggtatctcagcgcctttgcggaacgtggagtgacgcctgatctgaac
ctgatccgcgagtgcggcgaatggaccagtgccgagggcgctcaggcggtacgtgagatg
tatgcgcagggcattcgaccggatggcatttttgcgctgaatgatttgctggcgatgggt
gttatcagtcagctgcgggaaatgcgcgtgcgagtgccggaaagcgtgcgtgtggtgggc
ttcgatgatatcgatgaggctaagtacacgattccctcgctgaccactgtggatccgcag
cgcgcgcgtattgctgagattgccatcacgtcgattcttgatcaggtcaagacgggggct
cgggcgccgaggcggcgtattgatgtggagtattcgttgcgttaccgcgcttcctcgccg
caggtgtag

DBGET integrated database retrieval system