KEGG   Bifidobacterium longum subsp. longum JDM301: BLJ_0140Help
Entry
BLJ_0140          CDS       T01240                                 

Definition
(GenBank) TadE family protein
Organism
bll  Bifidobacterium longum subsp. longum JDM301
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TadE Tad DUF4244
Motif
Other DBs
NCBI-ProteinID: ADG99633
UniProt: D6ZXI7
Position
179807..180184
Genome map
AA seq 125 aa AA seqDB search
MKTMRCRWRLARLPPDLCTGSATAEFAIVLPSVIAIAGLILAMGRVVIVSMDCQGAATAA
AREFVVTGDESSARSIAADVAGGDPRVSIAHNGQSTSVMVECSVLPGPLDVTPTRVTGNA
TAISQ
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccatgagatgccggtggaggctcgccagactgccgccagacctatgcacggga
tcggccaccgccgaattcgcgatcgtattgcccagcgttatcgccatcgccgggctgata
ctggcaatgggacgtgtggtcatcgtttccatggactgccaaggtgccgcgacggcggct
gcacgcgagtttgtggttaccggtgacgaatcatccgcgcgcagcatagctgcggacgtt
gcagggggagatccccgcgtcagcattgcccacaacggccaatcgacgagcgtgatggtc
gaatgttcggtactgcccggcccactggatgtcactccaacgcgggtcaccggcaacgct
acggcgataagccaataa

DBGET integrated database retrieval system