KEGG   Bifidobacterium longum subsp. longum JDM301: BLJ_0519Help
Entry
BLJ_0519          CDS       T01240                                 

Definition
beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
bll  Bifidobacterium longum subsp. longum JDM301
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bll00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
648467..650542
Genome map
AA seq 691 aa AA seqDB search
MERKEFKWPQPLAGNKPRIWYGGDYNPDQWPEEVWDEDVALMQQAGVNLVSVAIFSWAKL
EPEEGVYDFDWLDRVIDKLGKAGIAVDLASGTASPPMWMTQAHPEILWVDYRGDVCQPGA
RQHWRATSPVFLDYALSLCRKMAEHYKDNPYVVSWHVSNEYGCHNRFDYSEDAERAFQKW
CEKKYGTIDAVNDAWGTAFWAQRMNNFSEIIPPRFIGDGNFMNPGKLLDWKRFSSDALLD
FYKAERDALLEIAPKPQTTNFMVSAGGAGIDYDKWGYDVDFVSNDHYFTPGEAHFDELAY
SASLCDGIARKNPWFLMEHSSSAVNWRPINYRVEPGELVRDSLAHLAMGSDAICYFQWRQ
SKAGAEKWHSSMVPHAGPDSQIFRDVCELGADLNKLADEGLLSTKLVKSKVAVVFDYESQ
WATEHTATPTQEVRHWTEPLAWFRALADNGLTADVVPVRGPWDEYEAVVLPSLTILSEET
TRRVREYVANGGKLFVTYYTGLVDDKDHVWLGGYPGSIRDVVGVRVEEFAPMGNDFPGAM
DHLDLDNGTVAHDFADVITSVADTAHVVASFKADKWTGFDGAPAITVNDFGDGKAAYVGA
RLGREGLAKSLPVLLEELGIETSAEDDRGEVLRVERADETGENHFVFLFNRTHDVAVVDV
EGEPLVASLAQVNESEHTAAIQPNGVLVVKL
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
atggaacgtaaagagttcaagtggccgcagccgcttgcgggcaacaagccccgcatctgg
tacggcggcgattacaaccccgaccaatggcctgaggaagtgtgggacgaagatgtagcc
ctcatgcagcaggccggcgtcaacctcgtctccgtagccatcttctcctgggccaagctt
gagcccgaagaaggcgtgtacgacttcgattggctcgaccgcgtcatcgacaagcttggt
aaggccggcatcgccgtcgatctcgcctccggcaccgcatccccgccgatgtggatgacc
caggcccacccggagatcctctgggtcgactaccgcggcgacgtctgccagcccggtgcc
cgccagcactggcgcgccaccagcccggtcttccttgactacgcgctcagcttgtgccgc
aagatggccgagcactacaaggacaacccctatgtggtctcttggcatgtgagcaacgag
tacggctgccacaaccgcttcgactattccgaagacgccgagcgcgccttccagaagtgg
tgcgagaagaagtacggcaccatcgacgccgtcaacgacgcttggggcaccgcattctgg
gcgcagcgcatgaacaatttttccgagatcatcccgccgcgcttcatcggcgacggcaac
ttcatgaacccgggcaagctgcttgactggaagcgcttcagctccgacgccctgctcgac
ttttacaaggccgagcgcgacgccctgctcgagatcgcccccaagccgcagaccaccaac
ttcatggtctccgccggcggtgccggcatcgattacgacaagtggggttacgacgtggac
ttcgtgtccaacgatcactacttcacgcctggcgaagctcacttcgacgagctggcttac
tcggcctccctatgtgacggcatcgcccgcaagaatccgtggttcctcatggagcactcc
agctccgccgtcaattggcgcccgatcaactatcgcgtcgagcccggcgaattggtgcgc
gactccctggcccacttggccatgggctccgacgccatctgctacttccagtggcgccag
tccaaggccggtgccgagaagtggcactcttcgatggttcctcacgcgggccccgactcc
cagatcttccgcgatgtgtgcgagctgggtgccgacctcaacaagcttgctgacgagggc
ctgctgagcaccaagctggtcaagtccaaggtcgccgtcgtcttcgattacgagtcccag
tgggctacggaacacaccgccacgcctactcaggaggtacgtcattggaccgagccgctc
gcgtggttccgcgcgctggcggacaacggtctgaccgcagacgtggtgccggttcgcggc
ccttgggacgagtacgaagccgtcgtgctgccgagcctgaccatcctgtccgaagagacc
acgcgccgcgtgcgcgagtatgtggcgaacggcggcaagctgttcgtgacctactacacc
ggtctggtggacgacaaggatcacgtctggctgggtggctaccccggttccatccgtgac
gtggtgggtgtgcgcgttgaggaattcgccccgatgggcaacgacttccccggtgccatg
gaccaccttgacttggacaacggaaccgtggcgcacgatttcgccgacgtgatcacctcc
gtggccgataccgctcacgtggtcgcctccttcaaggcggataagtggaccggtttcgac
ggcgctcccgccatcaccgtcaacgacttcggcgacggcaaggccgcatacgtcggtgcc
cgtctcggccgtgagggtttggccaagagcctgcccgtgctgctggaggaactcggcatc
gagacttcggctgaggacgatcgcggtgaagtgctgcgcgtcgagcgtgcggacgaaact
ggcgagaaccacttcgtgttcctgttcaaccgcacccacgatgttgcggtcgtggacgtg
gaaggcgaaccgctggtcgcctcgctggcccaggtcaacgaatccgagcacacggccgcc
atccagcccaacggcgtactcgtcgtcaagctgtaa

DBGET integrated database retrieval system