KEGG   Bifidobacterium longum subsp. longum JDM301: BLJ_0519Help
Entry
BLJ_0519          CDS       T01240                                 

Definition
beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
bll  Bifidobacterium longum subsp. longum JDM301
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:bll00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BLJ_0519
Enzymes [BR:bll01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     BLJ_0519
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
648467..650542
Genome map
AA seq 691 aa AA seqDB search
MERKEFKWPQPLAGNKPRIWYGGDYNPDQWPEEVWDEDVALMQQAGVNLVSVAIFSWAKL
EPEEGVYDFDWLDRVIDKLGKAGIAVDLASGTASPPMWMTQAHPEILWVDYRGDVCQPGA
RQHWRATSPVFLDYALSLCRKMAEHYKDNPYVVSWHVSNEYGCHNRFDYSEDAERAFQKW
CEKKYGTIDAVNDAWGTAFWAQRMNNFSEIIPPRFIGDGNFMNPGKLLDWKRFSSDALLD
FYKAERDALLEIAPKPQTTNFMVSAGGAGIDYDKWGYDVDFVSNDHYFTPGEAHFDELAY
SASLCDGIARKNPWFLMEHSSSAVNWRPINYRVEPGELVRDSLAHLAMGSDAICYFQWRQ
SKAGAEKWHSSMVPHAGPDSQIFRDVCELGADLNKLADEGLLSTKLVKSKVAVVFDYESQ
WATEHTATPTQEVRHWTEPLAWFRALADNGLTADVVPVRGPWDEYEAVVLPSLTILSEET
TRRVREYVANGGKLFVTYYTGLVDDKDHVWLGGYPGSIRDVVGVRVEEFAPMGNDFPGAM
DHLDLDNGTVAHDFADVITSVADTAHVVASFKADKWTGFDGAPAITVNDFGDGKAAYVGA
RLGREGLAKSLPVLLEELGIETSAEDDRGEVLRVERADETGENHFVFLFNRTHDVAVVDV
EGEPLVASLAQVNESEHTAAIQPNGVLVVKL
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
atggaacgtaaagagttcaagtggccgcagccgcttgcgggcaacaagccccgcatctgg
tacggcggcgattacaaccccgaccaatggcctgaggaagtgtgggacgaagatgtagcc
ctcatgcagcaggccggcgtcaacctcgtctccgtagccatcttctcctgggccaagctt
gagcccgaagaaggcgtgtacgacttcgattggctcgaccgcgtcatcgacaagcttggt
aaggccggcatcgccgtcgatctcgcctccggcaccgcatccccgccgatgtggatgacc
caggcccacccggagatcctctgggtcgactaccgcggcgacgtctgccagcccggtgcc
cgccagcactggcgcgccaccagcccggtcttccttgactacgcgctcagcttgtgccgc
aagatggccgagcactacaaggacaacccctatgtggtctcttggcatgtgagcaacgag
tacggctgccacaaccgcttcgactattccgaagacgccgagcgcgccttccagaagtgg
tgcgagaagaagtacggcaccatcgacgccgtcaacgacgcttggggcaccgcattctgg
gcgcagcgcatgaacaatttttccgagatcatcccgccgcgcttcatcggcgacggcaac
ttcatgaacccgggcaagctgcttgactggaagcgcttcagctccgacgccctgctcgac
ttttacaaggccgagcgcgacgccctgctcgagatcgcccccaagccgcagaccaccaac
ttcatggtctccgccggcggtgccggcatcgattacgacaagtggggttacgacgtggac
ttcgtgtccaacgatcactacttcacgcctggcgaagctcacttcgacgagctggcttac
tcggcctccctatgtgacggcatcgcccgcaagaatccgtggttcctcatggagcactcc
agctccgccgtcaattggcgcccgatcaactatcgcgtcgagcccggcgaattggtgcgc
gactccctggcccacttggccatgggctccgacgccatctgctacttccagtggcgccag
tccaaggccggtgccgagaagtggcactcttcgatggttcctcacgcgggccccgactcc
cagatcttccgcgatgtgtgcgagctgggtgccgacctcaacaagcttgctgacgagggc
ctgctgagcaccaagctggtcaagtccaaggtcgccgtcgtcttcgattacgagtcccag
tgggctacggaacacaccgccacgcctactcaggaggtacgtcattggaccgagccgctc
gcgtggttccgcgcgctggcggacaacggtctgaccgcagacgtggtgccggttcgcggc
ccttgggacgagtacgaagccgtcgtgctgccgagcctgaccatcctgtccgaagagacc
acgcgccgcgtgcgcgagtatgtggcgaacggcggcaagctgttcgtgacctactacacc
ggtctggtggacgacaaggatcacgtctggctgggtggctaccccggttccatccgtgac
gtggtgggtgtgcgcgttgaggaattcgccccgatgggcaacgacttccccggtgccatg
gaccaccttgacttggacaacggaaccgtggcgcacgatttcgccgacgtgatcacctcc
gtggccgataccgctcacgtggtcgcctccttcaaggcggataagtggaccggtttcgac
ggcgctcccgccatcaccgtcaacgacttcggcgacggcaaggccgcatacgtcggtgcc
cgtctcggccgtgagggtttggccaagagcctgcccgtgctgctggaggaactcggcatc
gagacttcggctgaggacgatcgcggtgaagtgctgcgcgtcgagcgtgcggacgaaact
ggcgagaaccacttcgtgttcctgttcaaccgcacccacgatgttgcggtcgtggacgtg
gaaggcgaaccgctggtcgcctcgctggcccaggtcaacgaatccgagcacacggccgcc
atccagcccaacggcgtactcgtcgtcaagctgtaa

DBGET integrated database retrieval system