KEGG   Bifidobacterium longum subsp. longum JDM301: BLJ_0603Help
Entry
BLJ_0603          CDS       T01240                                 

Definition
alcohol dehydrogenase GroES domain-containing protein
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
bll  Bifidobacterium longum subsp. longum JDM301
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bll00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BLJ_0603
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BLJ_0603
  Lipid metabolism
   00071 Fatty acid degradation
    BLJ_0603
  Amino acid metabolism
   00350 Tyrosine metabolism
    BLJ_0603
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BLJ_0603
   00626 Naphthalene degradation
    BLJ_0603
Enzymes [BR:bll01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BLJ_0603
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
749386..750429
Genome map
AA seq 347 aa AA seqDB search
MSETMKAAIFVEPGKMAVEEVPKATLEQDDDIVIRVVRTCVCGSDLWFFRGLSGQAAHSQ
VGHESIGVVEEVGAAVESVKPGDFVVVPFPYSCGKCPVCKAGFESVCPHGGYFSACQAEY
LRVPEADGTVVKVPGSPEDYDDATLASLLTVSDVMSTGYHAAVSAEVKPGDTAVVMGDGA
VGLCGVIAAKMRGATRVIAMSRHEDRAALAREFGATDIVPERGQEAIDKVLEMTGGYGAD
AVLECVGSKQSFDTAIGLVRRGGVIGRVGLPHDVEISAEGTFYGNVGIKGGPAPVRHYDI
DGGLLDAVLKGEINPGRVFTAEYDLDHIQDAYEAMDQRKVIKALIRF
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaaccatgaaagccgcgattttcgtggagcctggcaagatggccgtggaagaa
gtgccgaaggcgacgcttgaacaggatgatgacatcgtgatccgcgtggtgcgcacgtgc
gtgtgcggctctgatttgtggttcttccgtgggctgagcggacaggccgcgcacagccag
gtgggtcacgagtccatcggtgtggtcgaagaggttggcgcggcggtcgaatccgttaag
ccaggtgatttcgtggtcgtgccattcccgtacagctgcggcaagtgcccggtatgcaag
gccggcttcgaatccgtgtgcccgcacggcggctacttctccgcttgtcaggccgaatac
ctgcgtgtgcccgaggcggacggcaccgtggtcaaggtgcccggttcgccggaagactac
gatgacgcgacgctcgcttcgctgctgaccgtttccgatgtgatgtccaccggttatcac
gcggcggtttctgccgaggtcaagcccggtgacaccgccgtggtcatgggcgatggcgca
gttggcctgtgcggtgtgattgccgccaagatgcgcggtgccacgcgcgttattgccatg
agccgtcacgaggatcgcgcggcgctcgcccgcgaattcggtgcgactgatatcgtgccc
gagcgtggccaagaggctattgacaaggtgctggagatgaccggtggctatggtgcggac
gcggtgctcgaatgcgtgggctccaagcagtcgttcgacacggcgattggtctggttcgc
cgtggcggcgtgattgggcgcgtgggtctgccgcacgacgtggagatcagcgccgaaggc
acgttctacggcaacgtcggcatcaagggcggcccagctcccgtgcgccactacgatatt
gacggtggtctgctggatgcggtgcttaaaggcgagattaaccctggccgcgtgttcacc
gccgaatatgacctcgaccatattcaggacgcttatgaggccatggaccagcgcaaggtc
atcaaggcgctgatccggttctag

DBGET integrated database retrieval system