KEGG   Bifidobacterium longum subsp. longum JDM301: BLJ_0675Help
Entry
BLJ_0675          CDS       T01240                                 

Definition
family 3 glycoside hydrolase domain-containing protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bll  Bifidobacterium longum subsp. longum JDM301
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bll00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:bll00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(827380..828639)
Genome map
AA seq 419 aa AA seqDB search
MRPSAHATRQLRHRGIPIVAAICALAVVLAGVAVYGWHVGWFAKSTSNGNTTTPQTSQTS
ALPRTDVPSLKKNDDPAAQAQRAVSAMTLEERVGQLVMVPLFAGSEPSSLASTIADEHIG
SAILIGNWNTGVDTVKTATAQLQGYAPAGNRLIIATDQEGGQVQHLTGTGFDTMPSAVEQ
GTMSADALRQSAGTWGSQLATAGINVDLAPVLGTVVGNRASNAPIGALDRDFGLDAAGNA
EHGIAVIEGLRDAQVGAAVKHYPGLGAVSGNTDFTTEGILDTTTTLDGAEADAFDQAITK
ADPAMVMMSLATYQSIDPNNPAVFSSTIIDGHIRNVLKYTGVVISDSMSAEALSSYDVSQ
LGVNLVEAGGDMSCIGQTDYVKPIVDGLNERAKSDPAFASKVTAAATRVMTLKIKMGLA
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgcgtccctcagcacacgccacacgccaacttcggcacaggggcattccaatcgtggcg
gcaatatgtgctttggcggtggtgttggccggtgtggcagtctacggatggcatgtcgga
tggttcgccaaatccacatcaaacggcaacaccaccactccccagacctcccagacgagt
gcgttaccgcgcaccgacgttccttccctgaagaagaacgacgatccggcggcacaagcc
caacgtgcggtatccgccatgacgcttgaggaacgtgtgggacagttagtgatggtgccg
ttgttcgccggttccgaaccctcctcgttggcttcaacaatcgccgacgagcacattggc
tcggccattctcattggcaattggaataccggcgtcgatacggtcaagaccgcgaccgcg
caactccaaggatatgcgccggccggcaatcgtctcatcatcgccaccgatcaggagggg
ggtcaggtacagcatctgactggtaccggtttcgacacaatgcccagtgccgttgagcag
ggcacaatgtccgctgacgcattgcgtcaatcggcaggcacgtggggttcgcaattagcc
actgctggcataaatgtcgatttggcaccggtgcttggcacagtggttggcaatcgtgcc
tcaaatgctccgattggcgcgctggatcgtgatttcggattggatgcggccggcaacgcc
gaacatggcatcgccgttattgaaggtttgcgagacgctcaagtcggtgcggcggtcaaa
cattatcctgggttgggcgcggtaagcggcaataccgacttcaccaccgaaggcattctg
gatacgaccaccacgttggacggggccgaggcagatgcctttgaccaggcgattaccaag
gccgatcctgcgatggtgatgatgtcgttagccacgtatcaatccatcgacccgaataat
ccggcggtgttttcttctacgattatcgacggtcatattcgcaacgtcctgaagtacacg
ggcgtggtgatttcggattcgatgtctgccgaagcgttgagcagctacgatgtaagccaa
ttgggagtaaatcttgtcgaggcgggcggcgacatgtcctgcatcggtcagacggattat
gtaaagccaattgtggacggcctcaacgaacgggcgaagtccgatccggctttcgcttcg
aaggtgacggcggcggcgactcgcgtaatgacattgaaaatcaagatgggactggcctga

DBGET integrated database retrieval system