KEGG   Bifidobacterium longum subsp. longum JDM301: BLJ_0709Help
Entry
BLJ_0709          CDS       T01240                                 

Definition
1,4-alpha-glucan branching enzyme
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
bll  Bifidobacterium longum subsp. longum JDM301
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:bll00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BLJ_0709
Enzymes [BR:bll01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     BLJ_0709
Exosome [BR:bll04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BLJ_0709
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(865691..867943)
Genome map
AA seq 750 aa AA seqDB search
MAKETKIKEDTVTVPVAQGDLDAVSNAEFYNPHGVLGGHLGIGKHADTATIRVLRPLAKS
VTILTQDGEYPMTHEYNGVFVTTVPASGTKKQPTIPDYRVRTEWESGAVLIEDDPYRYMP
TVGDMDTYLFGEGRHEKLWEALGAHVLRYDDPMGGVDGTPGEQVVGTAFSVWAPNAHAVR
VVGNFNAWDGRRHAMRELGSSGVWEIFIPGIGAGETYKFQILNANYTWEMKADPMERQHE
VPPNTASIVTESTYEWNDDVWMQHRRTTNPHDGPVSIYEVHAGSWKQGLTYRDLAKQLVD
YVKQEGFTHVEFMPLAQHPFSGSWGYQVTGYYAVDSRLGSPDDFRYLVDQFHQAGIGVIM
DWVPAHFPKDAFALGRFDGTPLYEDPDPLRGEHPEWGTYVFNFGRREVRNFLVANALFWL
EDLHVDALRVDAVSSMLYLDYSREPGHWRPNIYGGRENLEAIDFLKEATATAYKNNPGVM
MIAEESTAWPGITAPTSAGGIGFGMKWNMGWMHDTLEYLHEEPINRKWHHNEITFSMVYA
YSEHYVLPISHDEVVYGKGSLYGKMPGDGWQKLAGVRSMFAYQWAHPGKKLSFMGNELAQ
WGEWDHDASIDWDCLNWQEHRQVQTMVADLNAFYKAHPALWSQDFDPAGFQWLTSDDADH
NTLSFLRIGTKGETLAVVVNFSGEAWSDYQVALPTGGKWTEVFTTDDAKYGGSDIHNGTF
EAVEGEYHSRPFSAKITVPALGVVFLKPED
NT seq 2253 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagaaacgaagatcaaggaagataccgtcaccgtgcctgtcgcccaaggcgac
ctcgatgcggtgagcaatgctgaattctacaacccccacggagttctcggcgggcatctc
ggcatcggcaagcatgccgacaccgccacaatccgtgtgctgcgtccgcttgccaagtcc
gtgaccatcctcacccaggatggcgaatacccgatgacccacgaatacaacggcgtgttc
gtgactaccgtgccggcttccggcaccaagaagcagcccacgattcccgactaccgcgtc
aggaccgagtgggaaagcggcgcagtgctcattgaggacgacccataccgttatatgccc
acagtcggcgacatggacacctatctgttcggcgagggccgtcacgagaagctctgggag
gcgcttggcgcgcatgtgctgcgctatgacgatccgatgggcggcgtggacggcacgcct
ggcgaacaggtggtaggcaccgcgttctccgtgtgggccccgaacgcccatgccgtgcgc
gtggtcggtaacttcaacgcctgggatggccgtcgtcatgccatgcgcgagctcggctcc
tccggcgtgtgggagatcttcatccccggcatcggcgcgggcgagacctacaagttccag
atcctgaacgccaattacacgtgggagatgaaggctgacccgatggagcgtcagcacgag
gttccgccgaacaccgcctccatcgtcaccgaatccacctacgagtggaacgatgacgtc
tggatgcagcaccgccgcaccaccaacccgcatgatggcccggtctccatctatgaggtg
cacgccggcagctggaagcagggactgacctaccgcgacctggccaagcagctcgtggac
tatgtcaagcaggaaggcttcacccacgtggagttcatgccactggcacagcacccgttc
tccggctcctggggctatcaggtcaccggctactatgcggtggattcccgcctcggctcc
cccgacgacttccgttacctggtcgatcagttccatcaggccggcatcggcgtgatcatg
gactgggtgcccgcccacttcccgaaggatgccttcgcactcggccgcttcgacggcacc
ccgctgtacgaggacccggacccgctgcgcggcgaacaccccgaatggggcacctatgtg
ttcaacttcggacgccgcgaagtacgcaacttcctggtggccaacgccctgttctggctc
gaggacctgcatgtcgatgcgctgcgcgtggatgccgtcagctccatgctctacctcgac
tacagccgcgaacccggccattggcgtccgaacatctacggcggacgcgaaaacctggag
gccatcgacttcctcaaggaagccaccgccaccgcgtacaagaacaaccccggcgtcatg
atgatcgccgaggagtccaccgcatggccgggcatcaccgcccccacctccgccggcggc
atcggcttcggtatgaagtggaacatgggatggatgcacgacaccctcgagtatctgcac
gaggagcccatcaaccgcaagtggcaccacaacgaaatcaccttctccatggtgtatgcc
tactccgaacactacgtattgcccatcagccacgacgaagtcgtgtacggcaagggctcc
ctgtacggcaagatgccgggcgatggctggcagaagctagccggcgtgcgttcgatgttc
gcctatcagtgggctcacccgggcaagaagctctccttcatgggcaacgagctggcccag
tggggcgagtgggatcacgacgcctccatcgattgggattgcctgaactggcaggagcac
cgtcaggtccagaccatggtcgccgacctcaacgccttctacaaggcgcatccggcacta
tggagccaggacttcgatccggccggcttccagtggctgaccagcgacgatgccgaccac
aacacgctgagcttcctgcgcatcggcaccaagggcgagaccttggccgtggtggtcaac
ttctccggtgaagcctggtccgattaccaggtggcgctgcccaccggcggcaagtggacc
gaagtgttcaccaccgatgacgccaagtacggcggctccgacatccacaacggcaccttc
gaagcggtcgagggcgaatatcattcgcgtccgttctcggcgaagatcaccgttccggct
ctgggagttgtattcttgaagccggaagactga

  All links  
No link information was found.   
DBGET integrated database retrieval system