KEGG   Bifidobacterium longum subsp. longum JDM301: BLJ_0749Help
Entry
BLJ_0749          CDS       T01240                                 

Definition
family 2 glycoside hydrolase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
bll  Bifidobacterium longum subsp. longum JDM301
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bll00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BLJ_0749
  Lipid metabolism
   00600 Sphingolipid metabolism
    BLJ_0749
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    BLJ_0749
Enzymes [BR:bll01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     BLJ_0749
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(907083..910154)
Genome map
AA seq 1023 aa AA seqDB search
MTDVTHVDRASQAWLTDPTVFEVNRTPAHSSHKWYARDPQSGQWSDLKQSLDGEWRVEVV
QAADINLEEEPATAESFDDSSFERIQVPGHLQTAGLMNHKYVNVQYPWDGHENPLEPNIP
ENNHVALYRRKFTVSAPVANAKQAGGSVSIVFHGMATAIYVWVNGAFVGYGEDGFTPNEF
DITGLLHDGENVVAVACYEYSSASWLEDQDFWRLHGLFRSVELAARPHVHIENTQIEADW
DPEAGTASLDAALTVLNAADAATVRATLKDADGNTVWQTTGDAKAQTALSSGPLQGIAPW
SAESPTLYELDVDVIDQSGDVIECTSQKVGFRRFRIEDGILTINGKRIVFKGADRHEFDA
ERGRAITEQDMIDDVVFCKRHNINSIRTSHYPNQERWYELCDEYGIYLIDETNLEAHGSW
SLPGDVLTEDTIVPGSKREWEGACVDRVNSMMRRDYNHPSVLIWSLGNESYVGDVFRAMY
KHVHDIDPNRPVHYEGVTHNRDYDDVTDIETRMYSHADEIEKYLKDDPKKPYLSCEYMHA
MGNSVGNMDEYTALERYPKYQGGFIWDFIDQAIYATQPDGTRSLRYGGDFGDRPSDYEFS
GDGLLFADRKPSPKAQEVKQLYSNVHIDVTKDSVSVKNDNLFTATGDYVFVLSVLADGKP
VWQSTRRFDVPAGETRTFDVAWPVAAYRADARELVLQVSQRLAKATDWAESGYELAFGQT
VVPADATATPDTKPADGTITVGRWNAGVRGAGREVLLSRTQGGMVSYTFAGNEFVLRRPA
ITTFRPLTDNDRGAGHGFERVQWLGAGRYARCVDNVLEQIDDSTLKGTYTYELATAQRTK
VTVSYTAHTDGRVNLHVEYPGEQGDLPTIPAFGIEWTLPVQYTNLRFFGTGPEETYLDRK
HAKLGVWSTNAFADHAPYLMPQETGNHEDVRWAEITDDHGHGMRVSRADGAAPFAVSLLP
YSSFMLEEAQHQDELPKPKHMFLRVLAAQMGVGGDDSWMSPVHSQYHIPADKPISLDVDL
ELI
NT seq 3072 nt NT seq  +upstreamnt  +downstreamnt
atgacagacgtcacacatgtcgatcgcgcatcgcaggcttggctgaccgacccgacggtg
ttcgaggtgaaccggactccggcccattccagccacaagtggtacgcccgtgacccccag
agcggacaatggtccgatctcaagcagagccttgacggcgagtggcgggttgaggtcgtt
caggccgccgacatcaacctcgaagaggaacccgcgacggccgagtcgttcgacgactcc
tcgttcgagcgtatccaggttccgggccacctgcagacggccggcctgatgaaccacaag
tacgtgaacgtccaatatccgtgggacggccacgagaacccgttggaaccgaacatcccg
gaaaacaatcacgtcgcgctctaccgcaggaagttcaccgtctccgcccccgtggcaaac
gccaagcaggccggcggatcggtgtcgatcgtgttccacggcatggccacggcgatctac
gtgtgggtcaacggcgcgttcgtcggctatggcgaggacggcttcacgcccaatgagttc
gacatcaccgggctgctgcacgacggggagaacgtcgtggccgtcgcctgctacgaatac
tccagcgcctcctggcttgaggatcaggacttctggcgtctgcacggcctgttccgctcc
gtcgaactcgccgcccgcccgcacgtgcacatcgagaacacgcagatcgaagccgattgg
gatcccgaggccggcaccgcctccctcgacgccgcgctgaccgtgctcaacgcggccgac
gcggccacggtccgcgcgactctgaaggacgccgacggcaacacggtgtggcagacgacg
ggcgacgcgaaggcgcagaccgcgctctccagcggaccgctgcagggcatcgccccctgg
agcgccgaaagcccgacgctgtacgagcttgacgtcgacgtcatcgaccagtcgggcgac
gtcatcgaatgcacgtcccagaaggtcggtttccgccgcttccgcatcgaggacggcatc
ctgaccatcaacggcaagcgcatcgtgttcaagggcgccgaccgccacgagttcgacgcc
gaacgcggccgcgccatcaccgagcaggacatgatcgatgacgtggtcttctgcaagcgt
cacaacatcaactccatccgcacctcgcactacccgaaccaggaacgctggtacgaactg
tgcgacgagtacggcatctacctgatcgacgagaccaacctcgaagcccacggcagctgg
tccctgcccggagacgtcctcaccgaggacaccatcgtgccgggcagcaagcgcgaatgg
gaaggcgcctgcgtcgaccgcgtcaacagcatgatgcgccgtgactacaaccacccgagc
gtgctgatctggtcgctgggcaacgaatcctacgtgggcgacgtgttccgcgccatgtac
aagcacgtgcacgacatcgacccgaaccgtccggtgcactacgagggcgtgacccacaac
cgtgactacgatgacgtcaccgacatcgagacccgcatgtactcgcatgccgacgagatc
gagaagtacctgaaggacgacccgaagaagccgtacctctcctgcgaatacatgcacgcc
atgggcaactccgtgggcaacatggacgaatacacggcgctcgaacgctacccgaagtat
cagggcggcttcatctgggacttcatcgaccaggccatctacgccacccagcccgacggc
accaggagcctgcgctacggcggagacttcggcgaccgtccgtccgactacgagttctcc
ggcgacggcctgctgttcgccgaccgcaagccgtcccccaaggcccaggaagtcaagcag
ctgtactcgaacgtccacatcgacgtgacgaaggactcggtgtccgtcaagaacgacaac
ctgttcaccgccaccggcgactacgtgttcgttctgagcgttctcgccgacggcaagccg
gtctggcagtccacccggcgtttcgacgtgcccgccggtgagacccgcacgttcgatgtc
gcatggccggtggcggcgtaccgcgccgacgcccgcgaactggtgctgcaggtttcgcag
cgtctcgccaaggcgaccgattgggccgagagcggctacgagctcgccttcggacagacc
gtggtgcccgcggacgccaccgcgacgcccgacacgaagccggccgatgggaccatcacc
gtgggccgttggaacgccggcgtgcgaggcgccggacgcgaggtcctgctgtcgcgcacc
cagggcggcatggtctcctacaccttcgccggcaacgagttcgtgctgcgccgtcccgca
atcaccaccttccgtccgctgaccgacaacgatcgcggcgccggtcacggtttcgagcgc
gtccagtggctgggcgccggccgctacgcccgctgcgtggacaacgtgctcgagcagatc
gatgacagcacgctcaagggcacgtacacgtatgagctcgccaccgcgcagcgcaccaag
gtgaccgtctcctacacggcccacaccgatggccgcgtgaacctgcacgtcgaatacccc
ggagagcagggtgacctgcccaccatcccggcgttcggcatcgaatggactctgcctgtg
cagtacacgaacctgaggttcttcggcaccggcccggaggagacgtacctggaccgcaag
cacgccaagctcggcgtgtggagcaccaacgccttcgccgatcatgcgccgtacctcatg
ccgcaggagacgggcaaccatgaggatgtgcgttgggccgagattaccgatgatcacggc
cacggcatgcgcgtcagccgcgccgatggcgccgcgccgttcgcggtaagcctgctgccg
tactccagcttcatgcttgaggaggcccagcaccaggacgagctgccgaagccgaagcac
atgttcctgcgcgtccttgccgcacagatgggcgtcggcggcgatgattcctggatgtcg
ccggtgcactcccagtaccatatcccggcggacaagccgatcagcctcgacgtcgatctc
gagctgatctga

DBGET integrated database retrieval system