KEGG   Bifidobacterium longum subsp. longum JDM301: BLJ_0759Help
Entry
BLJ_0759          CDS       T01240                                 

Definition
phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bll  Bifidobacterium longum subsp. longum JDM301
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bll00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BLJ_0759
   01230 Biosynthesis of amino acids
    BLJ_0759
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BLJ_0759
  Energy metabolism
   00680 Methane metabolism
    BLJ_0759
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BLJ_0759
Enzymes [BR:bll01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BLJ_0759
Exosome [BR:bll04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BLJ_0759
  Exosomal proteins of melanoma cells
   BLJ_0759
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(921865..922563)
Genome map
AA seq 232 aa AA seqDB search
MANHVRSIFLIRHGRTSYNAAHKLQGQVDIPLDAVGEWQVKQTAAALKSLYVDRRPEINH
RFIVCSDLKRAHATAQAFADVLGGIEPVDDHRVRERSFGDWDGHAVAELAERYPEDFRSW
MESRGGELKYGAEPKEAVGKRGVEALEDWSTRAGDDTDLFVFSHGAWIAQTLQTLLGISA
IDPTFSTVVSLRNAHWVRLVPMDNPDGAVRWRLLDYNHGPAIADTDEWERER
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atggccaatcatgttcgttccattttccttatccgtcatggacgcacttcctataacgcc
gctcacaagctccaaggccaggtcgacattccgctggacgccgtgggtgaatggcaggtc
aagcagaccgccgcggccttgaaaagcctgtacgtcgatcgtcggccggaaatcaaccac
cggttcattgtctgctccgatttgaagcgtgcgcacgccaccgcgcaggctttcgccgac
gtattgggtggaatcgagcccgtcgatgatcatcgcgtccgtgaacgcagcttcggcgac
tgggatggccatgccgtggctgaactggccgaacgctaccctgaggacttccgttcctgg
atggagtctcggggcggtgaactgaagtatggtgccgaacccaaggaagccgtaggcaaa
cgcggtgtggaggctcttgaggactggtccacgcgtgccggagacgacacggacctgttc
gtgttctcgcacggcgcatggatcgcgcagacattgcagaccctgttgggtatttccgcg
atcgatccgaccttctccacggtggtctcattgcgcaatgcgcactgggtgcgcttggtg
ccgatggacaatcccgatggcgctgtgcgctggcgtctgctggactacaatcacggtccg
gccatcgccgacaccgacgaatgggaacgcgaacgctga

DBGET integrated database retrieval system