KEGG   Bifidobacterium longum subsp. longum JDM301: BLJ_0759Help
Entry
BLJ_0759          CDS       T01240                                 

Definition
(GenBank) Phosphoglycerate mutase
  KO
K22306  
glucosyl-3-phosphoglycerate phosphatase [EC:3.1.3.85]
Organism
bll  Bifidobacterium longum subsp. longum JDM301
Brite
Enzymes [BR:bll01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.85  glucosyl-3-phosphoglycerate phosphatase
     BLJ_0759
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(921865..922563)
Genome map
AA seq 232 aa AA seqDB search
MANHVRSIFLIRHGRTSYNAAHKLQGQVDIPLDAVGEWQVKQTAAALKSLYVDRRPEINH
RFIVCSDLKRAHATAQAFADVLGGIEPVDDHRVRERSFGDWDGHAVAELAERYPEDFRSW
MESRGGELKYGAEPKEAVGKRGVEALEDWSTRAGDDTDLFVFSHGAWIAQTLQTLLGISA
IDPTFSTVVSLRNAHWVRLVPMDNPDGAVRWRLLDYNHGPAIADTDEWERER
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atggccaatcatgttcgttccattttccttatccgtcatggacgcacttcctataacgcc
gctcacaagctccaaggccaggtcgacattccgctggacgccgtgggtgaatggcaggtc
aagcagaccgccgcggccttgaaaagcctgtacgtcgatcgtcggccggaaatcaaccac
cggttcattgtctgctccgatttgaagcgtgcgcacgccaccgcgcaggctttcgccgac
gtattgggtggaatcgagcccgtcgatgatcatcgcgtccgtgaacgcagcttcggcgac
tgggatggccatgccgtggctgaactggccgaacgctaccctgaggacttccgttcctgg
atggagtctcggggcggtgaactgaagtatggtgccgaacccaaggaagccgtaggcaaa
cgcggtgtggaggctcttgaggactggtccacgcgtgccggagacgacacggacctgttc
gtgttctcgcacggcgcatggatcgcgcagacattgcagaccctgttgggtatttccgcg
atcgatccgaccttctccacggtggtctcattgcgcaatgcgcactgggtgcgcttggtg
ccgatggacaatcccgatggcgctgtgcgctggcgtctgctggactacaatcacggtccg
gccatcgccgacaccgacgaatgggaacgcgaacgctga

DBGET integrated database retrieval system