KEGG   Bifidobacterium longum subsp. longum JDM301: BLJ_0849Help
Entry
BLJ_0849          CDS       T01240                                 

Definition
isochorismatase hydrolase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
bll  Bifidobacterium longum subsp. longum JDM301
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bll00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    BLJ_0849
Enzymes [BR:bll01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     BLJ_0849
    3.5.1.-  
     BLJ_0849
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1023465..1024628)
Genome map
AA seq 387 aa AA seqDB search
MSPIHDGFDVIAIRVQHECGVIAGMVRARTGSAVVSAAGGERGCMERLHGLLTVSQERDV
CDRRDRRSLRLRPVNRRHVEIGVQGSVIHAESERGLMMRLDDIAERCERLFVECDATVDV
FHVQRQMVQHGLGHPPLVLVFDCCLQCKPERFPTGPRMAMMRAIARRVRDNIQNESKAIG
GMMMTKALIVVDMQPTFCEGGELGVEGGNAVAERIADYVNAHRSEYAYIATTQDWHIEPG
AHWSAEPDFVDTWPKHGAAGTPNAELHTAIKALNIQHHFKKGQYSAAYSGFEGIEDNTDR
IQTREEVAAEQSAGKTLANALKAAGVSRVDVVGIAESHCVKDTALDARKFGFEVTVFEDL
TVPVSKELGVAARKQMTTAGITLAESR
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgagcccaatccacgacggcttcgatgttattgccatccgggtccagcacgaatgcgga
gtaatagccgggatggtacgggcgcggaccgggagcgccgttgtctcggccgccggcggc
gagcgcggctgcatggaacgcctgcacggcttgctgactgtcagccaggaacgcgatgtg
tgtgaccggcgtgaccggcgaagcctccgcctccggcccgtcaatcggcgacacgtagaa
atcggagtgcagggttccgtcatccacgccgaatccgagcgtgggctcatgatgcgcctt
gacgatatagccgagcggtgcgagcgcctgtttgtagaatgtgatgctacggtcgatgtc
tttcacgtgcaacgtcagatggtccagcatggtcttggtcaccctcccctggttcttgta
ttcgattgctgcttgcagtgtaagcccgaacgtttccccacagggccgcgcatggctatg
atgagagcaatcgcacgtcgagttcgagacaatattcaaaacgaatccaaggcaataggg
ggaatgatgatgaccaaggcactgattgtggtggatatgcagccgacgttctgtgaaggc
ggcgaactgggagtcgaaggcggcaacgcggtcgccgagcggatcgccgattatgtgaac
gcgcatcgcagcgagtacgcgtatatcgcaaccacgcaggactggcatatcgagccgggc
gcgcactggtcggcggaaccggatttcgtggacacgtggccgaagcatggtgcggccggc
acgccgaacgccgaattgcatacggcgatcaaggcgctgaatatccagcatcatttcaag
aagggccagtattcggcggcatattccggttttgagggcatcgaggacaataccgaccgt
atccagacccgcgaggaggttgcggccgagcaatccgccggcaagacgctggccaatgcg
ctgaaggccgccggcgtgagtcgcgtggatgtggtgggcatcgccgaatcgcattgcgtc
aaggacaccgcgctcgatgccaggaagttcggtttcgaggtcaccgtgttcgaggacctg
accgtaccggtcagcaaggagctcggtgtcgcggcccgcaaacagatgacgacggccggc
atcacattggccgagtcccgctga

DBGET integrated database retrieval system