KEGG   Bifidobacterium longum subsp. longum JDM301: BLJ_0935Help
Entry
BLJ_0935          CDS       T01240                                 

Definition
type III restriction enzyme
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
bll  Bifidobacterium longum subsp. longum JDM301
Brite
Enzymes [BR:bll01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     BLJ_0935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1122307..1125531)
Genome map
AA seq 1074 aa AA seqDB search
MQFKFSQYQYQTDAADAVCDVFDGQPLQDGVSYIRDTGIRKPASQVLNPAQDTFDIPELR
PVQEMLGHFDADDDTGYRNADLLLDGERLLANIKNVQRRQNLTESPRLYTDPAGAVELDV
EMETGTGKTFVYTKTMFELNRRYGWSKFIVVVPSIAIREGVAKSLDMTGDYFYTSGRDGN
EGYGKKLHSFIYDSSNLNRLDEFAQSSDIQVMVINMQAFNTSMKENGRSKDARIIFSERD
DFGSRRPIDVISATHPIMILDEPQKMGGRATQAGIRLFKPLFTLNYSATHKTKHDLVYAL
DALDAYNQRLVKRIEVKGFELNNMRGTDGYLYLQDVIVSKNRAPQARIEYKKLSSAGKVV
TTSGLFDEGDDVYTASGGLEAYHDGWRIAPDGIVPDGLEPGRTGYVRFMNGETLGKGRIM
NDGSEADMRRVQIRETILSHLHKEEHLWARGIKCLSLFFIDEVAKYRRYDDDGEPLNGEY
ADMFEQEYDRCVHDFVENRLDDGSGYLDWLRTTHGRYVHKGYFSIDKHGHSIDSKVKRGS
EDSDDISAYDLILKNKERLLSFDEPTRFIFSHSALREGWDNPNVFQICTLKHSDNEVGKR
QEVGRGLRLCVNREGVRQDRNLLSDADFLDVNLLTVIASESYERFAESLQKDIETNLRER
PIVINDAFFVKTCVPADKLGPEYAGLGDVSFSKDEARDIVYALTVDRLIDRDGKLTDKYK
EERFGKDAVELLPEPSRKKVPAIRLVLDSVVEGTTKVLIGNALKRKVHGNPLNANWQKKE
FQELWRRINHKYAYTVSFNDDELVKNAVKAIDERLVVSKLSYTVTRGIQKENASRNELAD
RTHFHRNDSYTGGLDVDASNGVRYDLLGEIAQAATITRRCAARILKSIRPDRFLMFRDNP
EQFIARVGRLIVQEKANMVVDHICYDRIEGGYDSSIFTKGGNNRDEAEGYQASKCVQDWV
FPDGRIESDFAKDLDNAAEVAVYAKLPRGFQIPTPVGNYAPDWAVAFRDDSGLKHLFFVA
ETKGTMDSFELRGIEDSKIACAKRLFNQLDLAGGTRYEQATTYQTLLDEVKALQ
NT seq 3225 nt NT seq  +upstreamnt  +downstreamnt
atgcaattcaaattctcgcaataccagtaccagaccgatgctgcggacgcggtatgcgac
gtgttcgacggccagccgctgcaggatggcgtctcctatatccgcgacaccggtatccgt
aagcccgcatcccaagtgctcaatcccgctcaggacactttcgatatccccgagttgagg
ccggtgcaggagatgctcggccatttcgacgcggatgacgacacgggctaccgcaacgcg
gacctgctgctggacggcgaaaggctgctcgccaacatcaaaaacgtgcaacgccggcag
aacctgacggaatccccgaggctgtacacggatccggccggtgccgtcgaactggacgtg
gagatggagaccggcacgggcaagacgttcgtgtacacgaagaccatgttcgaattgaac
cgcaggtatggctggtcgaagttcatcgtcgtggtcccgtccatcgccatccgcgagggc
gtcgccaaatcgttggacatgacaggcgactatttctacacgtccggccgcgacggcaac
gagggctatgggaagaaactgcactccttcatctacgactcgtcgaatctgaaccggctg
gacgagttcgcccagtcctcggacatccaagtgatggtcatcaacatgcaggcgttcaac
acgtctatgaaggagaacgggcgcagcaaggacgcgagaatcatcttctcggaacgtgac
gatttcggctcgcgccgcccaatcgacgtgatcagtgcgactcatccgatcatgatcctg
gacgagccgcagaagatgggcggcagggctacgcaggcgggcatacgcctgttcaaacca
ttgttcacactgaactattccgccacgcacaaaacgaagcacgacctcgtgtatgcgctg
gacgcgctggacgcgtacaaccagcgtctggtcaagcgcatcgaagtcaagggcttcgag
ctgaacaacatgcgcggcaccgacggctacctgtatttgcaggacgtcatcgtcagcaaa
aacagggcgccgcaggcccgtatcgaatacaagaagctgtcctcggccggtaaggtcgtg
accacgtccggactgttcgacgagggcgacgacgtctataccgcgtccggcgggctagag
gcgtaccacgacggctggcgcatcgctccggacggcatcgtgcccgacggcctggagccg
ggccggaccggctacgtgcggttcatgaatggcgagacgctcggcaagggccgtatcatg
aacgacggatccgaggcagacatgcgccgcgtgcagatccgcgagaccatcctctcccac
ctgcacaaggaggagcacctgtgggcacgaggcatcaaatgcctgagcctgttcttcatc
gacgaggtcgcgaaataccgacggtacgacgatgacggcgagccgttgaacggcgagtac
gcggacatgttcgagcaggagtacgaccgttgcgtgcatgatttcgtcgagaaccgtctc
gacgacgggtccggctatctcgactggctacgcaccacacacggccgttacgtgcacaag
ggatatttcagcatcgacaagcacggtcattccatcgactcgaaagtcaaacgcgggtcg
gaagacagcgacgacatcagcgcatacgacctgattctgaaaaacaaggaacgactgttg
agcttcgacgagcccacgaggttcatcttcagtcattccgcgctgcgcgagggatgggac
aacccgaacgtgttccagatctgcacgttgaagcattcggacaacgaggtcggcaaacgt
caggaggtcggacgcggcctgcgcctgtgcgtgaaccgcgagggcgtgcgtcaggatcgt
aacctgctcagcgacgcggacttccttgacgtgaacctgttgaccgttatcgcgtcggaa
agctacgaaaggttcgccgaaagcctgcagaaggacatcgagaccaacctgcgagagcgg
ccaatcgtcatcaacgatgcgttcttcgtcaagacatgcgttccggccgacaagctcggt
ccggagtatgcgggcttgggagacgtgtcgttcagcaaggacgaggcgcgtgacatcgtg
tacgcgctgaccgtggaccggctcatcgaccgcgacggcaagctgaccgacaagtacaag
gaagagcgtttcggcaaggatgcggtggaacttctgccagaaccctcgcgaaagaaggtc
ccggcaatccgtctcgtgctggacagcgtggtggaaggcaccaccaaggtgctgatcggc
aacgcattgaagcgtaaggtacatggcaatccgctcaatgccaactggcagaagaaggag
ttccaggagctctggaggcgcatcaaccacaagtatgcgtataccgtcagcttcaacgac
gacgaactcgtcaaaaacgcagtcaaggcaattgacgagcgtctggtcgtatcgaaactg
tcctacacggtcacgcgcggcatccagaaggagaatgcctcacgcaacgagctcgcggac
cgcacacacttccacaggaacgactcctataccggtggcttggatgtcgacgcttcgaac
ggcgtgagatacgatctgctcggcgagatcgcgcaggccgcgaccatcacgcgtcgttgt
gcggcacgcattctcaagagcattcggccggaccggttcctcatgttcagggacaatcca
gagcagttcatcgcgagggtcggccgtctgattgttcaggagaaggcgaacatggtcgtt
gaccatatctgctacgaccggatcgaaggcggatacgattcgagcatcttcaccaagggc
ggcaacaatcgtgatgaggccgaaggctatcaggcgtctaagtgcgtgcaggactgggtg
ttccccgatggcaggatcgaaagcgatttcgccaaggacctcgataacgcggcggaagtc
gcggtgtatgcgaaactgccgcgtggattccagatcccgactcctgtgggcaactacgcc
cccgactgggctgtggccttccgcgacgacagcggtctcaagcacctgttcttcgtcgcc
gaaaccaaaggcacgatggacagtttcgaattgcgcgggattgaggacagcaagatcgcc
tgcgcgaaacgtctgttcaaccaactcgatctcgccggcggaacccgttacgagcaggcc
accacctatcagaccctgcttgacgaagtgaaagcactgcaatag

DBGET integrated database retrieval system