KEGG   Bifidobacterium longum subsp. longum JDM301: BLJ_1013Help
Entry
BLJ_1013          CDS       T01240                                 

Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bll  Bifidobacterium longum subsp. longum JDM301
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bll00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BLJ_1013
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BLJ_1013
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BLJ_1013
Enzymes [BR:bll01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BLJ_1013
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1199758..1201845
Genome map
AA seq 695 aa AA seqDB search
MSVLDELVAGALEDQRTRELTVSLEDVKKAALAAPAPIDATRWLKRADGIPVIAEIKRAS
PSKGHLSDIPDPAALAREYEKGGASAISVLTEGRRFLGSLDDFDKVRAAVHIPVLRKDFI
VTDYQIFEARAHGADLVLLIVAALDDAQLKHLLDLAHELNMTVLMETHTREEIERARKAG
AKVIGINARNLKNLKVDVNKYNELAADLPDDVIKVAESGVFGAVEVEDYARAGADAVLVG
EGVATADDHELAVERLVKAGAQVKASETTPLSEHQGPYWGQFGGRYVPEALITALDELER
VYTQAKADPEFHKEFMTLQQRYVGRPSPLTEAPRFAALVKQKTGLDARIFLKREDLNHTG
AHKINNALGQALLVKRMGKTRVIAETGAGQHGVATATVCAMLGLKCRIYMGQIDARRQAL
NVARMRMLGAEVVEVTLGDKILKDAINEALRDWVTNVKDTHYLLGTVAGPHPFPAMVRDF
QKIIGEEAKQQLQDWYGIDHPDAICACVGGGSNAIGVMNAFLDDERVNLYGYEAGGNGPE
SGKHAIRFAPGTGQLGMFQGAKSYLLETDEGQTLDTYSISAGLDYASVGPEHAWLKDIGR
VNYSWATDEEAMNAFRDLSQAEGIIPAIESSHAVAGAYKAAADLKAKGYDKAVMIVNISG
RGDKDMATAGKWFGYLTDDQAAALDVAGAHGNTVA
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
atgtcggttttggacgaactggtggcgggagcgctggaggatcagcgcacccgtgagctc
accgtatcgcttgaggacgtgaagaaggccgcgctggcggccccggctccgattgacgcg
acacgatggcttaagcgcgccgacggcatccccgtgatcgccgagatcaagcgcgcgtct
ccgtccaagggccacctgtccgacatcccggacccggccgcgctggctcgcgagtacgag
aagggcggcgcaagcgccatctccgtgctcaccgaaggccgcagattcctcggcagcctt
gacgatttcgacaaggtccgcgccgccgtgcacattccagtgctgcgcaaggacttcatc
gtcaccgactaccagatcttcgaggcccgcgcccacggcgccgacctggtgctgctcatc
gtcgccgcattggacgacgcccagctcaagcacctgctcgacctggcgcacgagttgaac
atgactgtgctgatggaaacgcatacccgcgaggagatcgaacgcgcccgcaaggccggt
gccaaggtgatcggcatcaatgcgcgcaacctgaagaacctcaaggtggacgtgaacaaa
tacaacgaactcgcggccgatctgcccgatgacgtcatcaaggtggcggaatccggcgta
ttcggcgcggtcgaggtcgaagactacgcccgcgcgggagcggatgcggtactggtcggc
gagggcgtggccaccgctgatgatcatgaacttgcagtggaacgactagtaaaggcagga
gcacaagtgaaagcatccgaaacaaccccgctcagcgaacatcagggaccgtattggggg
cagttcggtggccgctatgtgcccgaggccctcatcaccgccctcgacgagctggagcgc
gtgtacacgcaagccaaggccgaccccgaattccacaaggaattcatgacgctccagcag
cgttacgtgggccgtccgagtccgctgaccgaagccccgcgcttcgccgcactggtcaag
cagaagaccggtctcgacgcccgtatcttcctcaagcgcgaggacttgaaccacaccggc
gcgcacaagatcaacaacgcgctcggccaggccctgctcgtcaagcggatgggcaagacc
cgcgtgatcgcggagaccggcgccggtcagcacggcgtggccaccgccaccgtgtgcgcc
atgctcggcctcaagtgccgcatctacatgggccagatcgacgcccgccgtcaggccctg
aacgtggcccgcatgcgtatgctcggcgccgaagtggtcgaggtgaccctcggcgacaag
atcctgaaggatgccatcaacgaagccctgcgcgactgggtcaccaacgtcaaggacacg
cactacctgctcggcaccgtcgcgggcccacacccgttcccggccatggtgcgcgacttc
cagaagatcatcggcgaggaagccaagcagcagctccaggactggtacggcatcgaccat
ccggacgcgatctgcgcctgcgtgggcggcggctccaacgccatcggcgtgatgaacgcc
ttcctggacgacgagcgcgtgaacctctacggctacgaagccggcggcaacggccccgaa
tccggcaagcacgccatccgcttcgcccccggcaccggccagctcggcatgttccagggc
gccaagagctacctgctggaaaccgacgaaggccagacgctcgacacctactcgatctcc
gcaggcctcgactatgcgtccgtgggccccgagcacgcatggctcaaggatatcggccgc
gtgaactacagctgggccaccgacgaggaggccatgaacgccttccgcgacctgagccag
gccgagggcatcatccccgccatcgaaagctcgcacgccgtggccggcgcgtacaaggcc
gccgccgatctgaaagccaagggctatgacaaggccgtgatgatcgtgaacatctccggc
cgaggcgacaaggacatggccaccgccggcaagtggttcggctacctgaccgacgatcag
gccgccgcgctcgatgtggccggcgcccacggcaatactgtcgcctga

DBGET integrated database retrieval system