KEGG   Bifidobacterium longum subsp. longum JDM301: BLJ_1014Help
Entry
BLJ_1014          CDS       T01240                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bll  Bifidobacterium longum subsp. longum JDM301
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bll00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BLJ_1014 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BLJ_1014 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BLJ_1014 (trpA)
Enzymes [BR:bll01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BLJ_1014 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1201863..1202738
Genome map
AA seq 291 aa AA seqDB search
MIMTNEATTPSGQPLGISHKPSKSVAMFTKFKAENKPAFIGYLPYGFPNPDVSLDAFKTM
VEHGVDAVEIGLPYSDPVMDGPVIQAAASIALNNGETIKRVFEAVETVANAGGVPLIMSY
WNLVYHYGVERFARDFENAGGAGLITPDLIPDEAGEWIEASDRHGLDRIFLVSPDSSTER
LETVARNARGFVYAAARMGVTGERATIDASPELLVERTRQAGAENVCVGIGVSTAEQGAK
VGSYADGAIVGSALVHTLLADDNKTARDPKEGLKLLAAKSEELAEGIHNAR
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
ttgattatgaccaacgaagcaaccacgccgtccggccagccgctgggcatcagccacaag
cccagcaagtcggtcgctatgttcaccaagttcaaggccgagaacaagcccgccttcatc
ggctacctgccctacggcttccccaacccggacgtctcgcttgacgccttcaagacgatg
gtcgagcacggcgtcgacgccgtggaaatcggcctgccgtactccgacccggtcatggac
ggcccggtcatccaggctgccgcctccatcgccctgaacaacggcgagaccatcaagcgc
gtgttcgaggccgtcgagaccgtggccaacgccggcggcgtgccgctcatcatgagctac
tggaacctcgtgtaccactacggcgtcgagcgtttcgcccgtgacttcgagaacgccggc
ggcgccggcctcatcaccccggacctcatcccggacgaggcgggggagtggatcgaagcc
tccgaccgtcacggactcgaccgcatcttcctggtctccccggattcgtccaccgagcgc
cttgaaaccgtggcccgcaacgcgcgtggcttcgtgtacgcagccgcccgcatgggcgtc
accggcgaacgcgccaccatcgacgcctcgcccgaactcctcgtggagcgcacccgtcag
gccggtgccgagaacgtgtgcgtgggcatcggcgtgtccaccgccgaacagggcgccaag
gtcggctcctacgcggacggcgccatcgtcggctccgcgcttgtgcacaccctgctcgcg
gacgacaacaagaccgcacgcgacccgaaggaaggcttgaagctgctcgccgccaagagc
gaggaactggccgaaggcatccacaacgcccggtga

DBGET integrated database retrieval system