KEGG   Bifidobacterium longum subsp. longum JDM301: BLJ_1040Help
Entry
BLJ_1040          CDS       T01240                                 

Definition
succinate--CoA ligase
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
bll  Bifidobacterium longum subsp. longum JDM301
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:bll01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:bll00020]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:bll00640]
Metabolism; Carbohydrate metabolism; C5-Branched dibasic acid metabolism [PATH:bll00660]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1227128..1228330)
Genome map
AA seq 400 aa AA seqDB search
MDLYEYQARQLLEEQDIPTPDAIFAQNSHEVAEAADKIGYPCVIKAQVKIGHRGQAGGVK
IAHNRDEAILESESILPMTIHGHKVSGVLVAEAKNILHEYYVSISVDRTSRDFDVLATAN
GGTEVEEIAKEHPEAVKRLHIDALGDFDLAAATEMAQSIGFYHADVDQAAQILLKMWRCF
KDNDATLVEINPLAKIGDPDDESTKQLSALDAKISLDDNASFRHDGWARFVDLIVPDPFE
QRAREHGLHYVHLHGEVGVIGNGAGLVMSSLDAVSGAGEEQGTNIKPANFLDIGGGASAA
VMAESLEIVLSDPQVESVFINVYGGITSCVEVANGILEAVAKLGGSKPIVVRFDGNAAAE
GLHILASANNPNIHVSETMEGAAAKAAQLAGEATQSKEVR
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggatctttacgaataccaggcgcgtcagctgctcgaggaacaggacattcccaccccg
gacgccatctttgcccagaactcccatgaagtcgccgaagcggcggacaaaatcggctat
ccctgcgtaatcaaggcgcaggtcaagatcggtcatcgtggtcaggccggcggcgtcaag
atcgcccataaccgcgacgaggcgattcttgaatccgagtccatcctgccgatgaccatc
cacgggcacaaggtttccggcgtgcttgtggccgaagccaagaacatcctgcacgaatat
tacgtgtccatctccgtggaccgcacctcgcgcgacttcgacgtgctggccaccgccaac
ggcggcaccgaagtcgaggaaatcgccaaggaacatccggaggccgtcaagcgcctgcac
atcgatgcgctcggcgacttcgacctggccgctgccaccgaaatggcacagagcatcggc
ttctaccacgcggacgtcgatcaggccgcacagattctgctcaagatgtggcgctgtttc
aaagacaacgatgccacgctcgtggaaatcaatccactcgccaagatcggcgacccggat
gacgaatccaccaagcagctgagcgccttggacgccaagatctccttggatgacaacgcc
tccttccgccatgatggctgggcgcgtttcgtggatctcatcgttcccgaccccttcgaa
cagcgcgcccgcgaacacggcctgcactacgtgcacctgcacggcgaggtcggtgtgatc
ggcaacggcgcaggactcgtcatgagttccctggatgccgtctccggcgctggcgaggaa
cagggcaccaacatcaagcccgccaacttcctggacatcggcggcggcgcctccgcagcc
gtcatggccgaaagcctggagatcgtactgtccgaccctcaggtcgaatccgtgttcatc
aatgtctatggcggcatcacctcctgcgtggaagtcgccaacggcatcctcgaagcggtc
gccaagctcggcggttccaagccgatcgtcgtgcgtttcgatggcaacgccgccgccgag
ggtctgcatatcctcgcttccgccaacaatccgaatatccatgtgtccgaaaccatggaa
ggcgcggcagccaaggccgcgcagctcgccggtgaggcgacccagtccaaggaggttcgc
tga

DBGET integrated database retrieval system