KEGG   Bifidobacterium longum subsp. longum JDM301: BLJ_1040Help
Entry
BLJ_1040          CDS       T01240                                 

Definition
succinate--CoA ligase
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
bll  Bifidobacterium longum subsp. longum JDM301
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bll00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BLJ_1040
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BLJ_1040
   00640 Propanoate metabolism
    BLJ_1040
   00660 C5-Branched dibasic acid metabolism
    BLJ_1040
Enzymes [BR:bll01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     BLJ_1040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1227128..1228330)
Genome map
AA seq 400 aa AA seqDB search
MDLYEYQARQLLEEQDIPTPDAIFAQNSHEVAEAADKIGYPCVIKAQVKIGHRGQAGGVK
IAHNRDEAILESESILPMTIHGHKVSGVLVAEAKNILHEYYVSISVDRTSRDFDVLATAN
GGTEVEEIAKEHPEAVKRLHIDALGDFDLAAATEMAQSIGFYHADVDQAAQILLKMWRCF
KDNDATLVEINPLAKIGDPDDESTKQLSALDAKISLDDNASFRHDGWARFVDLIVPDPFE
QRAREHGLHYVHLHGEVGVIGNGAGLVMSSLDAVSGAGEEQGTNIKPANFLDIGGGASAA
VMAESLEIVLSDPQVESVFINVYGGITSCVEVANGILEAVAKLGGSKPIVVRFDGNAAAE
GLHILASANNPNIHVSETMEGAAAKAAQLAGEATQSKEVR
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggatctttacgaataccaggcgcgtcagctgctcgaggaacaggacattcccaccccg
gacgccatctttgcccagaactcccatgaagtcgccgaagcggcggacaaaatcggctat
ccctgcgtaatcaaggcgcaggtcaagatcggtcatcgtggtcaggccggcggcgtcaag
atcgcccataaccgcgacgaggcgattcttgaatccgagtccatcctgccgatgaccatc
cacgggcacaaggtttccggcgtgcttgtggccgaagccaagaacatcctgcacgaatat
tacgtgtccatctccgtggaccgcacctcgcgcgacttcgacgtgctggccaccgccaac
ggcggcaccgaagtcgaggaaatcgccaaggaacatccggaggccgtcaagcgcctgcac
atcgatgcgctcggcgacttcgacctggccgctgccaccgaaatggcacagagcatcggc
ttctaccacgcggacgtcgatcaggccgcacagattctgctcaagatgtggcgctgtttc
aaagacaacgatgccacgctcgtggaaatcaatccactcgccaagatcggcgacccggat
gacgaatccaccaagcagctgagcgccttggacgccaagatctccttggatgacaacgcc
tccttccgccatgatggctgggcgcgtttcgtggatctcatcgttcccgaccccttcgaa
cagcgcgcccgcgaacacggcctgcactacgtgcacctgcacggcgaggtcggtgtgatc
ggcaacggcgcaggactcgtcatgagttccctggatgccgtctccggcgctggcgaggaa
cagggcaccaacatcaagcccgccaacttcctggacatcggcggcggcgcctccgcagcc
gtcatggccgaaagcctggagatcgtactgtccgaccctcaggtcgaatccgtgttcatc
aatgtctatggcggcatcacctcctgcgtggaagtcgccaacggcatcctcgaagcggtc
gccaagctcggcggttccaagccgatcgtcgtgcgtttcgatggcaacgccgccgccgag
ggtctgcatatcctcgcttccgccaacaatccgaatatccatgtgtccgaaaccatggaa
ggcgcggcagccaaggccgcgcagctcgccggtgaggcgacccagtccaaggaggttcgc
tga

  All links  
No link information was found.   
DBGET integrated database retrieval system