KEGG   Bifidobacterium longum subsp. longum JDM301: BLJ_1139Help
Entry
BLJ_1139          CDS       T01240                                 

Definition
(GenBank) Phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bll  Bifidobacterium longum subsp. longum JDM301
Pathway
bll00010  Glycolysis / Gluconeogenesis
bll00260  Glycine, serine and threonine metabolism
bll00680  Methane metabolism
bll01100  Metabolic pathways
bll01110  Biosynthesis of secondary metabolites
bll01120  Microbial metabolism in diverse environments
bll01130  Biosynthesis of antibiotics
bll01200  Carbon metabolism
bll01230  Biosynthesis of amino acids
Module
bll_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bll00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BLJ_1139
  Energy metabolism
   00680 Methane metabolism
    BLJ_1139
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BLJ_1139
Enzymes [BR:bll01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BLJ_1139
Membrane trafficking [BR:bll04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    BLJ_1139
Exosome [BR:bll04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BLJ_1139
  Exosomal proteins of melanoma cells
   BLJ_1139
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 Glyco_hydro_108
Motif
Other DBs
NCBI-ProteinID: ADH00591
UniProt: D6ZUN5
Position
complement(1327956..1328801)
Genome map
AA seq 281 aa AA seqDB search
MIDEVMMLRHGRTQYNLEHRLQGQIDVPLDIVGQWQVDQTGFALASRYYWAKVNRLAEHP
EAIAQPGPDAAERTDTRQFEEAPAAGRRMVVMTSDLFRAQQTAHAFADILGLPVTCDQRL
RERSFGEWEGMTRAEIKAVAADDYASWKQHTGGETKHGVESRAAVGQRGADAVRALVTDS
AYSDSMPTTLMLVTHGSWITATISNLLELDPDGMNALGGMRNACWCRLKVRHSVNGTPTE
QPLWELEEYNKAPAIADSADWENGPTDLRGPHMPSWQPIVW
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatgaagtgatgatgctgcgtcatggccgtacgcaatacaatctcgaacatcgc
ttgcaaggccagatcgatgtgccgctcgacatcgtaggccaatggcaggtcgaccagacc
ggattcgcgctcgcttcacggtattactgggccaaggtgaaccgacttgccgagcatccc
gaagccatcgcccagcccggtcctgacgccgccgaacgcactgatacgcgacagttcgag
gaggctcccgccgccggccggcgcatggtggtgatgacctccgacctgttccgtgcccaa
cagaccgcacacgccttcgccgatattttgggattgccggtcacctgtgaccaacgactg
cgtgaacgcagcttcggcgagtgggaaggcatgacccgcgccgaaatcaaagccgtggca
gccgacgactacgcctcttggaaacagcacactgggggcgaaaccaagcatggtgtggaa
agccgtgccgccgtgggccagcgaggtgccgatgccgtgcgcgcactggtcaccgactcc
gcctattcagacagcatgcccaccacgctgatgctcgtcacccatggctcatggattacc
gccaccatctccaacctactcgaactcgacccggacggcatgaacgcactcggcggcatg
cgcaacgcctgctggtgccggctcaaagtgcgccacagcgtcaacggcacccccaccgaa
cagcccctgtgggagttggaggaatacaacaaggctcccgccatcgccgacagcgccgac
tgggagaacgggccgaccgatctgcgaggaccgcacatgccgagttggcagccaatcgtc
tggtga

DBGET integrated database retrieval system