KEGG   Bifidobacterium longum subsp. longum JDM301: BLJ_1139Help
Entry
BLJ_1139          CDS       T01240                                 

Definition
phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bll  Bifidobacterium longum subsp. longum JDM301
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bll00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BLJ_1139
   01230 Biosynthesis of amino acids
    BLJ_1139
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BLJ_1139
  Energy metabolism
   00680 Methane metabolism
    BLJ_1139
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BLJ_1139
Enzymes [BR:bll01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BLJ_1139
Exosome [BR:bll04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BLJ_1139
  Exosomal proteins of melanoma cells
   BLJ_1139
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1327956..1328801)
Genome map
AA seq 281 aa AA seqDB search
MIDEVMMLRHGRTQYNLEHRLQGQIDVPLDIVGQWQVDQTGFALASRYYWAKVNRLAEHP
EAIAQPGPDAAERTDTRQFEEAPAAGRRMVVMTSDLFRAQQTAHAFADILGLPVTCDQRL
RERSFGEWEGMTRAEIKAVAADDYASWKQHTGGETKHGVESRAAVGQRGADAVRALVTDS
AYSDSMPTTLMLVTHGSWITATISNLLELDPDGMNALGGMRNACWCRLKVRHSVNGTPTE
QPLWELEEYNKAPAIADSADWENGPTDLRGPHMPSWQPIVW
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatgaagtgatgatgctgcgtcatggccgtacgcaatacaatctcgaacatcgc
ttgcaaggccagatcgatgtgccgctcgacatcgtaggccaatggcaggtcgaccagacc
ggattcgcgctcgcttcacggtattactgggccaaggtgaaccgacttgccgagcatccc
gaagccatcgcccagcccggtcctgacgccgccgaacgcactgatacgcgacagttcgag
gaggctcccgccgccggccggcgcatggtggtgatgacctccgacctgttccgtgcccaa
cagaccgcacacgccttcgccgatattttgggattgccggtcacctgtgaccaacgactg
cgtgaacgcagcttcggcgagtgggaaggcatgacccgcgccgaaatcaaagccgtggca
gccgacgactacgcctcttggaaacagcacactgggggcgaaaccaagcatggtgtggaa
agccgtgccgccgtgggccagcgaggtgccgatgccgtgcgcgcactggtcaccgactcc
gcctattcagacagcatgcccaccacgctgatgctcgtcacccatggctcatggattacc
gccaccatctccaacctactcgaactcgacccggacggcatgaacgcactcggcggcatg
cgcaacgcctgctggtgccggctcaaagtgcgccacagcgtcaacggcacccccaccgaa
cagcccctgtgggagttggaggaatacaacaaggctcccgccatcgccgacagcgccgac
tgggagaacgggccgaccgatctgcgaggaccgcacatgccgagttggcagccaatcgtc
tggtga

DBGET integrated database retrieval system