KEGG   Bifidobacterium longum subsp. longum JDM301: BLJ_1139Help
Entry
BLJ_1139          CDS       T01240                                 

Definition
phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bll  Bifidobacterium longum subsp. longum JDM301
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:bll01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:bll01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bll00010]
Metabolism; Energy metabolism; Methane metabolism [PATH:bll00680]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:bll00260]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1327956..1328801)
Genome map
AA seq 281 aa AA seqDB search
MIDEVMMLRHGRTQYNLEHRLQGQIDVPLDIVGQWQVDQTGFALASRYYWAKVNRLAEHP
EAIAQPGPDAAERTDTRQFEEAPAAGRRMVVMTSDLFRAQQTAHAFADILGLPVTCDQRL
RERSFGEWEGMTRAEIKAVAADDYASWKQHTGGETKHGVESRAAVGQRGADAVRALVTDS
AYSDSMPTTLMLVTHGSWITATISNLLELDPDGMNALGGMRNACWCRLKVRHSVNGTPTE
QPLWELEEYNKAPAIADSADWENGPTDLRGPHMPSWQPIVW
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatgaagtgatgatgctgcgtcatggccgtacgcaatacaatctcgaacatcgc
ttgcaaggccagatcgatgtgccgctcgacatcgtaggccaatggcaggtcgaccagacc
ggattcgcgctcgcttcacggtattactgggccaaggtgaaccgacttgccgagcatccc
gaagccatcgcccagcccggtcctgacgccgccgaacgcactgatacgcgacagttcgag
gaggctcccgccgccggccggcgcatggtggtgatgacctccgacctgttccgtgcccaa
cagaccgcacacgccttcgccgatattttgggattgccggtcacctgtgaccaacgactg
cgtgaacgcagcttcggcgagtgggaaggcatgacccgcgccgaaatcaaagccgtggca
gccgacgactacgcctcttggaaacagcacactgggggcgaaaccaagcatggtgtggaa
agccgtgccgccgtgggccagcgaggtgccgatgccgtgcgcgcactggtcaccgactcc
gcctattcagacagcatgcccaccacgctgatgctcgtcacccatggctcatggattacc
gccaccatctccaacctactcgaactcgacccggacggcatgaacgcactcggcggcatg
cgcaacgcctgctggtgccggctcaaagtgcgccacagcgtcaacggcacccccaccgaa
cagcccctgtgggagttggaggaatacaacaaggctcccgccatcgccgacagcgccgac
tgggagaacgggccgaccgatctgcgaggaccgcacatgccgagttggcagccaatcgtc
tggtga

DBGET integrated database retrieval system