KEGG   Bifidobacterium longum subsp. longum JDM301: BLJ_1622Help
Entry
BLJ_1622          CDS       T01240                                 

Definition
(GenBank) putative glucokinase, ROK family
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
bll  Bifidobacterium longum subsp. longum JDM301
Pathway
bll00010  Glycolysis / Gluconeogenesis
bll00052  Galactose metabolism
bll00500  Starch and sucrose metabolism
bll00520  Amino sugar and nucleotide sugar metabolism
bll00521  Streptomycin biosynthesis
bll01100  Metabolic pathways
bll01110  Biosynthesis of secondary metabolites
bll01120  Microbial metabolism in diverse environments
bll01130  Biosynthesis of antibiotics
bll01200  Carbon metabolism
Module
bll_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bll00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BLJ_1622
   00052 Galactose metabolism
    BLJ_1622
   00500 Starch and sucrose metabolism
    BLJ_1622
   00520 Amino sugar and nucleotide sugar metabolism
    BLJ_1622
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BLJ_1622
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    BLJ_1622
Enzymes [BR:bll01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BLJ_1622
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Pan_kinase Glucokinase BcrAD_BadFG FtsA FGGY_N Hydant_A_N
Motif
Other DBs
NCBI-ProteinID: ADH01061
UniProt: D6ZW05
Position
complement(1940195..1941145)
Genome map
AA seq 316 aa AA seqDB search
MTTLAIDIGGTKIAAAVCDENDSIIQRWRVPTPMDADAINQHIAEVYREAVAAGHTDIEA
VGISAAGNVSADRKTLTFSANIPAWINYDLSEHVGALIDHAVPVIVENDANCAGWGEFVH
GAGQGSSNMVALTVGTGLGGAIVINGQLYRGSFGMAAELGHLPMVPDGDHCGCGLRGCAE
RYTSGTSLENFAKSAVRRRPQDAKRLLELCGGDITKLEGPMVSQAAQEGDVLGLYAFGKI
GEWLGRTMAAVSAVLDPDLFVIGGGVVAVGDILLEPARYNYQRFLEGSAYRGHAKIVAAT
AGQDAGLIGAANLALR
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgctcgccattgatatcggaggaaccaagatcgccgccgccgtctgcgatgaa
aatgacagcatcatccagcgctggcgcgtccccacgccgatggacgccgacgccatcaac
cagcacatcgccgaggtgtaccgcgaggctgtggccgccgggcacaccgatatcgaggcc
gtcggcatctccgccgccggcaatgtgagcgcggatcgcaagacgctcaccttctccgcc
aacattccggcatggatcaactacgatctgtccgagcacgtcggcgcgctgatcgaccat
gccgtgccggtcatcgtcgaaaacgacgccaactgcgccggatggggcgaattcgtgcac
ggcgccggccagggtagctccaacatggtcgcgctgaccgtgggcaccggcctcggcggt
gccatcgtgatcaacggccagctctaccgcggctccttcggcatggccgccgagctcggc
cacctgccgatggtcccggacggcgaccactgcggctgcggcctgcgcggctgcgccgaa
cgttacacttcgggaacctcgctggagaacttcgccaagtccgccgtgcgccgtcgtcct
caggatgccaagcgtcttctggaactgtgcggcggcgacatcaccaaactggaggggccg
atggtgtcccaagcggctcaggaaggtgacgtacttggcctgtatgcgttcggcaagatc
ggcgaatggctgggccgcaccatggccgccgtttccgccgtgcttgacccggacctgttc
gtgatcggcggcggcgtggtggccgtgggcgacatcctgctggagccggcccgctacaac
taccagcgtttcctggaaggcagcgcctaccgcggccatgccaagatcgtcgcggccact
gcgggccaggatgccggtctgatcggcgcggccaacctggctctgcgctga

DBGET integrated database retrieval system