KEGG   Bifidobacterium longum subsp. longum JDM301: BLJ_1622Help
Entry
BLJ_1622          CDS       T01240                                 

Definition
putative glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
bll  Bifidobacterium longum subsp. longum JDM301
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bll00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BLJ_1622
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BLJ_1622
   00052 Galactose metabolism
    BLJ_1622
   00500 Starch and sucrose metabolism
    BLJ_1622
   00520 Amino sugar and nucleotide sugar metabolism
    BLJ_1622
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BLJ_1622
   00524 Butirosin and neomycin biosynthesis
    BLJ_1622
Enzymes [BR:bll01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BLJ_1622
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1940195..1941145)
Genome map
AA seq 316 aa AA seqDB search
MTTLAIDIGGTKIAAAVCDENDSIIQRWRVPTPMDADAINQHIAEVYREAVAAGHTDIEA
VGISAAGNVSADRKTLTFSANIPAWINYDLSEHVGALIDHAVPVIVENDANCAGWGEFVH
GAGQGSSNMVALTVGTGLGGAIVINGQLYRGSFGMAAELGHLPMVPDGDHCGCGLRGCAE
RYTSGTSLENFAKSAVRRRPQDAKRLLELCGGDITKLEGPMVSQAAQEGDVLGLYAFGKI
GEWLGRTMAAVSAVLDPDLFVIGGGVVAVGDILLEPARYNYQRFLEGSAYRGHAKIVAAT
AGQDAGLIGAANLALR
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgctcgccattgatatcggaggaaccaagatcgccgccgccgtctgcgatgaa
aatgacagcatcatccagcgctggcgcgtccccacgccgatggacgccgacgccatcaac
cagcacatcgccgaggtgtaccgcgaggctgtggccgccgggcacaccgatatcgaggcc
gtcggcatctccgccgccggcaatgtgagcgcggatcgcaagacgctcaccttctccgcc
aacattccggcatggatcaactacgatctgtccgagcacgtcggcgcgctgatcgaccat
gccgtgccggtcatcgtcgaaaacgacgccaactgcgccggatggggcgaattcgtgcac
ggcgccggccagggtagctccaacatggtcgcgctgaccgtgggcaccggcctcggcggt
gccatcgtgatcaacggccagctctaccgcggctccttcggcatggccgccgagctcggc
cacctgccgatggtcccggacggcgaccactgcggctgcggcctgcgcggctgcgccgaa
cgttacacttcgggaacctcgctggagaacttcgccaagtccgccgtgcgccgtcgtcct
caggatgccaagcgtcttctggaactgtgcggcggcgacatcaccaaactggaggggccg
atggtgtcccaagcggctcaggaaggtgacgtacttggcctgtatgcgttcggcaagatc
ggcgaatggctgggccgcaccatggccgccgtttccgccgtgcttgacccggacctgttc
gtgatcggcggcggcgtggtggccgtgggcgacatcctgctggagccggcccgctacaac
taccagcgtttcctggaaggcagcgcctaccgcggccatgccaagatcgtcgcggccact
gcgggccaggatgccggtctgatcggcgcggccaacctggctctgcgctga

DBGET integrated database retrieval system