KEGG   Bifidobacterium longum subsp. longum JDM301: BLJ_1629Help
Entry
BLJ_1629          CDS       T01240                                 

Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
bll  Bifidobacterium longum subsp. longum JDM301
Pathway
bll00790  Folate biosynthesis
bll01100  Metabolic pathways
Module
bll_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bll00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BLJ_1629
Enzymes [BR:bll01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     BLJ_1629
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: ADH01067
UniProt: D6ZW11
Position
complement(1949248..1950123)
Genome map
AA seq 291 aa AA seqDB search
MTDLQALHDSTHTMVMGVLNITEDSVSDGGLWLDPAKAAQHGRDMMAAGAAIIDIGAEST
RPGAKRVSEADELARITGAVKTLIPAGAILSIDTTRASVAAAALSEGARIINDVSGGTLD
AELPHVVADHDCLYIVQHWRGWLAGSKGANPDQDTSVYEHGVLTDVHDELMRQVDGVLAA
GVKPERIIIDPGLGFSKPGIEHNLPLLTGLETFRATGYPVLIGQSRKRFISAMLTEAGAA
GADGPIMAQRDDVTAALSALSAEHGAWAVRVHDVAKSRAAVIAGNTWREYA
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgactgatttgcaggcgttgcatgacagtacgcacaccatggtgatgggtgtgctcaac
atcaccgaggactcggtctcggacggcggcctgtggctggacccggccaaggcggcccag
cacgggcgcgacatgatggccgccggcgcggccatcatcgacatcggcgccgaatccacg
cgccccggcgccaagcgcgtgtccgaggccgacgaactggcccgcatcaccggtgccgtc
aagacattgattccggccggtgccatactgtccatcgacaccacgcgcgcatccgtggcc
gccgctgcgctgagcgagggcgcccggatcatcaacgacgtttccggtggcacgctggat
gccgaactgccgcatgtggtcgccgaccacgactgcctatacatcgtgcagcattggcgc
ggttggctcgccggctccaagggcgcgaaccccgatcaagacacctccgtctacgagcac
ggtgtattgaccgacgtacacgacgaactcatgcgccaagtcgacggtgtgctggccgcc
ggcgtaaagcctgagcgcattatcatcgacccgggcctgggtttctccaagcccggcatc
gagcacaacctgccgctgctgaccggactcgagaccttccgcgccactggatatccggtg
ctgatcggccagtcccgcaaacgcttcatctcggcgatgcttaccgaggcgggcgctgcc
ggtgctgatgggccgatcatggcccagcgcgatgacgtgaccgcagccttgtccgccctg
tccgccgaacatggcgcatgggccgtgcgcgtacacgacgtggccaaaagccgcgccgcc
gtcatcgccggcaacacctggcgcgaatacgcatga

DBGET integrated database retrieval system