KEGG   Bifidobacterium longum subsp. longum JDM301: BLJ_1756Help
Entry
BLJ_1756          CDS       T01240                                 

Definition
iron-containing alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
bll  Bifidobacterium longum subsp. longum JDM301
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bll00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BLJ_1756
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BLJ_1756
   00620 Pyruvate metabolism
    BLJ_1756
   00650 Butanoate metabolism
    BLJ_1756
  Lipid metabolism
   00071 Fatty acid degradation
    BLJ_1756
  Amino acid metabolism
   00350 Tyrosine metabolism
    BLJ_1756
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BLJ_1756
   00626 Naphthalene degradation
    BLJ_1756
Enzymes [BR:bll01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BLJ_1756
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     BLJ_1756
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2081527..2084256)
Genome map
AA seq 909 aa AA seqDB search
MAEAKKKVEAANPTPEEKQAAAEAEVDALVARAKKALDEFENLDQKQVDRIVAKASIAAL
NKHLVLAKMAVDETGRGLVEDKATKNIFACEHVTNYLAGQKTVGIIREDDVMGIDEVAEP
VGVVAGVTPVTNPTSTAIFKSLIALKTRCPIVFGFHPGAQKCSVEAAKIVRDAAIEAGAP
ENCIQWIEHPSIQATGALMQHPGVATILATGGPGMVKAAYSSGKPALGVGAGNAPAYVDS
DVDIVRAANDLVLSKHFDYGMICATEQAIIAHKDVYDQLIKELKVRKAYFVNAEEKAKLE
QYMFGCTAGSGVKPVLNSVVPGKSPQFIAKAAGFEIPADATILAAECKEVSDDEPLTHEK
LAPVQAVLKADNKEQAFEMCEKMLKLGAGHTAAIHTNNQELVREYGVRMHACRIIWNQPS
SLGGIGDIYNAIAPSLTLGCGSYGGNSVSGNVQAVNLVNIKRIARRNNNMQWFKIPAKTY
FEPNAIKYLRDMYGIEKAVIVCDKVMEQLGIVDKVIDQLRARSNRVTFRIIDYVEPEPSV
ETVEKGAEMMREEFEPDTIIAVGGGSPMDASKIMWLLYEHPEIAFSDVREKFFDIRKRAF
KIPPLGKKAKLVCIPTSSGTGSEVTPFAVITDHKTGYKYPITDYALTPSVAIVDPVLART
QPRKLASDAGFDALTHSMEAYVSVYANDFTDGMALHAAKLIWDNLAESVNGEPGLAKTDA
QEKMHNAATMAGMAFGSAFLGMCHGMAHTIGALCHIAHGRTNSILLPYVIRYNGQIPEEP
TSWPKYNKYIAPERYQDIARNLGIDTGKTPAEAVENLAKAVEDYRDNKLGMNKSFQDCGV
DEDYFWSVLDQIGMRAYEDQCTPANPRIPLINDMKDIAVGAYYGVSQAEGHKLRIEREGE
AATEEASER
NT seq 2730 nt NT seq  +upstreamnt  +downstreamnt
gtggcagaagcaaagaagaaagtcgaagctgccaatccgaccccagaagagaagcaggcc
gcagctgaggccgaagttgacgcgctggttgcccgcgccaagaaggctctcgacgaattc
gagaacctcgaccagaagcaagttgatcgaatcgtcgccaaggcctccatcgccgctctg
aacaagcacctcgttctcgccaagatggccgtcgacgagaccggccgtggtctcgtggaa
gacaaggccaccaagaacatcttcgcctgtgagcacgtcaccaactacctggccggccag
aagaccgtcggcatcatccgcgaagacgacgtgatgggcatcgatgaggtcgccgagccc
gtcggcgtggtcgccggtgtcaccccggttaccaacccgacctccaccgccatcttcaag
tccctcatcgccctgaagacacgctgcccgatcgtcttcggcttccaccccggcgcgcag
aagtgctccgtcgaggccgccaagatcgtgcgcgacgccgccatcgaggccggtgctccc
gagaactgtatccagtggatcgagcacccgtccatccaggccaccggcgcgctgatgcag
cacccgggcgtggccacgatcctcgccaccggtggtccgggcatggtcaaggccgcttac
tcctccggcaagcccgccctcggcgtgggtgccggcaacgccccggcctatgttgattcc
gatgtggacatcgtccgtgccgccaacgatctggtgctctccaagcacttcgattacggc
atgatctgcgccaccgagcaggccatcatcgcccacaaggacgtctacgaccagctcatc
aaggagctcaaggtccgtaaggcctacttcgtcaacgccgaagagaaggccaagctggag
cagtacatgttcggctgcaccgccggttccggcgtcaagcccgtgctgaactccgtggtg
ccgggcaagtccccgcagttcatcgccaaggctgctggcttcgagattccggccgacgcc
accattctggccgccgagtgcaaggaagtctccgacgacgagccgctgacccacgagaag
ctcgctccggtgcaggccgtgctcaaggccgacaacaaggagcaggccttcgagatgtgc
gagaagatgctcaagctgggtgccggccacaccgccgccatccacaccaacaaccaggag
ctcgtgcgtgagtacggcgtccgtatgcacgcctgccgcatcatctggaaccagccttcc
tcccttggcggcatcggcgacatctacaatgccatcgccccgtcgctgaccctgggctgc
ggctcctacggcggcaactcggtgtccggcaacgtgcaggccgtgaatctcgtcaacatc
aagcgcattgctcggaggaacaacaacatgcagtggttcaagatcccggccaagacctac
ttcgagccgaacgccatcaagtacctgcgcgacatgtacggcatcgagaaggccgtcatc
gtgtgcgataaggtcatggagcagctcggcattgtcgacaaggtcatcgaccagctgcgc
gcccgctccaaccgtgtgaccttccgcatcatcgactacgtcgagccggagccctccgtc
gagaccgtcgaaaagggcgcggagatgatgcgcgaggagttcgagccggacacgatcatc
gcggttggcggcggctccccgatggatgcctccaagatcatgtggctgctctacgagcac
ccggaaatcgccttctccgacgtgcgcgagaagttcttcgatatccgtaagcgcgccttc
aagatcccgccgctgggcaagaaggccaagctcgtgtgcatcccgacctcctccggcacc
ggttccgaggtcaccccgttcgccgtgatcaccgatcacaagaccggctacaagtacccg
atcaccgactacgcgctgaccccgtccgtggccatcgtggacccggtgctggctcgcacc
cagccgcgcaagctggcctccgacgccggcttcgacgccctgacccactcgatggaagca
tacgtgtccgtgtacgcgaacgacttcaccgacggcatggccctgcacgcggccaagctc
atctgggacaacctggctgagtccgtcaacggcgagcccggcctggccaagaccgacgct
caggagaagatgcacaacgccgccaccatggccggcatggcattcggctccgcgttcctc
ggcatgtgccacggcatggcccacaccatcggtgccctgtgccacatcgcccacggccgt
accaactccatcctgctgccgtacgtgattcgctacaacggccagattcctgaggagccc
acctcttggccgaagtacaacaagtacatcgccccggagcgctaccaggacatcgcccgc
aacctcggcatcgacaccggcaagaccccggccgaagccgtggagaacctggcgaaggct
gtcgaggactaccgcgataacaagcttggtatgaacaagagcttccaggattgcggcgtg
gacgaggattacttctggtccgtgctcgatcagatcggcatgcgcgcctacgaggaccag
tgcaccccggccaacccgcgcatcccgctgatcaacgacatgaaggacatcgccgtcggt
gcttactacggcgtctcccaggcggaaggccacaagctacgcatcgagcgcgagggtgag
gccgccactgaggaagcctccgagcgctga

DBGET integrated database retrieval system