KEGG   Bifidobacterium longum subsp. longum JDM301: BLJ_1831Help
Entry
BLJ_1831          CDS       T01240                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
bll  Bifidobacterium longum subsp. longum JDM301
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bll00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BLJ_1831
  Amino acid metabolism
   00300 Lysine biosynthesis
    BLJ_1831
Enzymes [BR:bll01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     BLJ_1831
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2176267..2177601)
Genome map
AA seq 444 aa AA seqDB search
MALIRPDIILPFATPVWHIKMYSAAKSHVVGVLGPPPTRYAVHMTLELNRTASTAEQLNS
LLTQIMENFSVSDHEGPLTDEVEAFLNEQEHLTVRRHGDTVVASTDFGEPNRVILAGHLD
TVPVIDNFPPKWLEPGDSLIREEIAHAHPEDRVLWGRGATDMKASDAVMLYLAATLDGRT
PETTPKVDLTYVFYDHEEVVAEKNGLRKVVEAHPDWITGDFAIIGEPTNSGIEGGCNGTI
RFDVVTHGVAAHSARAWMGENAIHKAADILSRLNAYEPATVNVDGLDYREGLNATLISGG
KGTNVIPDECRVHVNYRFAPDKSLAEAKALMMGADAGAELGNGEHVATGGVFEGYGIEMK
DESPSARPGLNAPLAQDLVRLVKERTGRDPLAKLGWTDVARFSQLGIPAVNLGAGDPLLA
HKHDEQVPESDLAAMTAILTDWLV
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgattagacctgacataatcctccctttcgccaccccagtgtggcacataaaa
atgtattcggccgcaaaatctcatgtagtgggtgtgctgggcccgccgcccacgcggtac
gctgttcacatgacgcttgaattgaaccgcaccgcatccactgccgagcagctgaacagc
ctgctcacccagatcatggagaacttctccgtgtccgaccacgagggccccctcaccgac
gaggtcgaggccttccttaacgagcaagagcacctgaccgtccgccgtcacggcgacaca
gtggtggccagcaccgacttcggcgagccgaaccgtgtgatcttggccgggcacctcgat
actgtgccggtcatcgacaatttcccaccgaagtggctggagcccggcgattcgctgatt
cgcgaagaaatcgcccacgctcatcccgaagaccgcgtgctgtggggccgcggtgccacc
gatatgaaggcttccgacgcggtgatgctctacctcgccgccacgctcgacggccgcacg
ccggaaaccaccccgaaagtcgacctcacctacgtcttctacgaccatgaggaagtcgtc
gccgaaaagaacggccttcgcaaagtcgtcgaggcccatcccgattggatcaccggcgat
ttcgccatcatcggcgagcccaccaacagcggcatcgagggcggttgcaacggcacgatt
cgcttcgacgtcgtgacccacggcgtggcagcgcactccgcccgcgcgtggatgggggag
aacgccatccacaaggcggccgacatcctgagccgactcaacgcctacgagccggccacc
gtgaacgtggacgggctcgactatcgcgagggcctcaacgccacgctgatttccggcggc
aaaggcacgaacgtcattccggatgaatgccgcgtacacgtcaactaccgcttcgccccg
gacaagtcgctggccgaggccaaggctctgatgatgggcgcggatgccggtgccgaactc
ggcaatggcgagcatgtggccactggcggcgtgttcgagggctacggcatcgaaatgaag
gacgaaagcccctccgcgcgcccgggcctgaacgccccgctcgcccaagatctggtccga
ctggtcaaggagcgcaccggccgcgacccgttggccaagctcggctggaccgacgtggca
cgcttctcccagctcggcatcccggccgtcaacctcggtgccggcgacccgctgctggcg
cacaagcacgacgagcaggtgcccgaatccgacctggccgccatgaccgcaattcttacc
gactggctggtctga

DBGET integrated database retrieval system