KEGG   Bifidobacterium longum subsp. longum JDM301: BLJ_2031Help
Entry
BLJ_2031          CDS       T01240                                 

Definition
4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
bll  Bifidobacterium longum subsp. longum JDM301
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:bll00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2459664..2460614
Genome map
AA seq 316 aa AA seqDB search
MSPVISHPRPAAARHQFDELSPITITVDCPAKTNLTLEVGPAHDEWGGRHELDTTYCAIG
VYDTVTATAKQPGAGFSLELEGAYLGDLASSRSDMRRNHAVLALFAMAQAAEREPDVALT
ITKRIPVGAGLGGGSADAAATMLAVNRLWELNWPIERLRTIAATLGADMPFCLTGGLAYG
TGFGERITDIAPGSRDELALIEQGFSGEVLVGAYQSQLSTPEVYHTFDLVGAAEGDRNHL
QAAAISLHPRSGQAIDAATQAGASHAFVSGSGPSVVAFAADEAAAQRIIDVWRDTAVVDR
IIRAKSPAHPNIGVRQ
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgagtccggtaatctcacatccacgcccagccgctgcccgacatcagttcgatgagctc
tcccccatcaccattacggtggattgcccggcgaaaaccaatctcaccttggaagtgggg
cctgctcacgacgaatggggcggacgccacgaactggacaccacctactgtgcaatcggc
gtatacgacaccgtcaccgcaaccgccaagcaacccggagcgggattctctctggagctc
gaaggcgcttatttgggcgacttggcctcctcacgcagcgacatgcgccgcaaccatgcg
gtactggccctcttcgccatggcccaggcggccgagcgcgagccggatgtggcgttgacc
atcaccaagcgcattcccgtgggtgccggactaggcggcggctcagccgacgccgcggcg
accatgctggcggtcaatcgtctctgggagctgaactggcctatagagcgtctgcgcacc
attgccgccacgttgggcgcggatatgccgttctgcctgaccggtggccttgcatacggt
accggtttcggcgaacgcatcacggatatcgcccccggcagccgcgatgagctggcgctg
atagaacagggattcagcggcgaagtattggtcggcgcgtaccagtcgcaactcagcact
cctgaggtctaccacacctttgacctcgtgggagccgcagaaggcgaccgcaatcatctg
caggctgcggcaatcagcctgcatccccgcagcgggcaggccatcgacgccgccacgcag
gcgggtgccagccatgcattcgtctccggatccggcccctcagtggtcgctttcgccgcc
gacgaggcagcggcacaacgcattatcgatgtgtggcgcgatacggctgtggtcgatcgc
attattcgagccaaatctcccgcacaccccaatatcggcgtcagacagtga

DBGET integrated database retrieval system