KEGG   Bifidobacterium longum subsp. longum JCM 1217: BLLJ_0066Help
Entry
BLLJ_0066         CDS       T01419                                 

Definition
hypothetical protein
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
blm  Bifidobacterium longum subsp. longum JCM 1217
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:blm00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
82196..83296
Genome map
AA seq 366 aa AA seqDB search
MGAMQVTMIDENKYAETMTDVVLPALEQCCEEGWFDPSAAERSAGIEPLSGIMDTGGRSG
QLHYLCYDSAKFDAIREQGATATFRGAIVISHGFTEFAEKYDELVWYFLLAGYSVCVLEH
RGHGKSARDVDNRCMVWIDDWQRYVADLAGFAETIGQQYAAGMPLNLFCHSMGGGIGAAV
LERYPTLFDKAVLSAPMIAPATGMPLGVARVLVGALCGLGFGKKRVFGQSGFTPEFSMEG
NEGASEARERWYFKLRCENSEYQTYCAAFEWVRQALKLNRAILNPSACAEVETPVLLFQS
GRDIWVLNKPQNHFVQLVKDGGGEANIVRFPESRHEIFSMPNSTYKPYLEKILGFYDDPM
IACAAY
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgggagccatgcaggtgacgatgatcgacgaaaacaagtacgccgaaacgatgaccgac
gtggtgctgcccgcgctcgaacaatgctgcgaggagggctggttcgatccgtccgccgcc
gaacgttcggccgggatcgagccgctgtccggcattatggacaccggcggccgctcgggc
cagctgcactacctgtgctacgactccgccaaattcgacgcgattcgcgagcaaggcgcc
accgccaccttccgcggggccatcgtcatcagccacggcttcaccgagttcgccgaaaag
tacgacgagctcgtctggtacttcctgcttgccggctactcggtgtgtgtactcgagcat
cgcggccacggcaagtccgcgcgcgacgtggacaaccgctgcatggtgtggattgatgac
tggcagcgctacgtggccgatctggccggcttcgccgaaaccatcggccagcagtacgcg
gccggcatgccgctgaacctgttctgccattcgatgggcggcggcatcggcgcggccgtg
ttggagcgataccccaccctgttcgacaaagcggtgctctctgccccgatgatcgccccc
gccaccggcatgccgctgggcgtggcccgtgtgctggtcggcgcgctgtgcggactcggc
ttcggcaagaagcgcgtgttcgggcagtcgggcttcacgccggaattctcgatggaaggc
aacgagggcgcttccgaagcgcgtgaacgctggtacttcaagctgcgttgcgagaatagc
gaataccagacctactgcgcggcgttcgaatgggtgcgccaagcgttgaagctcaaccgg
gccatactgaatccgtccgcctgcgccgaagtggagacgccggtgctgctcttccagtcc
ggacgcgacatctgggtactcaataagccgcagaatcacttcgtccaactggtcaaggac
ggcggcggcgaggcgaacatcgtgcgcttccccgaatcgcgccacgaaatcttctccatg
cccaacagcacttacaagccctacctcgaaaagatcctcggcttctacgacgaccccatg
attgcctgcgccgcgtactga

DBGET integrated database retrieval system