KEGG   Bifidobacterium longum subsp. longum JCM 1217: BLLJ_0066Help
Entry
BLLJ_0066         CDS       T01419                                 

Definition
hypothetical protein
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
blm  Bifidobacterium longum subsp. longum JCM 1217
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:blm00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    BLLJ_0066
Enzymes [BR:blm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     BLLJ_0066
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
82196..83296
Genome map
AA seq 366 aa AA seqDB search
MGAMQVTMIDENKYAETMTDVVLPALEQCCEEGWFDPSAAERSAGIEPLSGIMDTGGRSG
QLHYLCYDSAKFDAIREQGATATFRGAIVISHGFTEFAEKYDELVWYFLLAGYSVCVLEH
RGHGKSARDVDNRCMVWIDDWQRYVADLAGFAETIGQQYAAGMPLNLFCHSMGGGIGAAV
LERYPTLFDKAVLSAPMIAPATGMPLGVARVLVGALCGLGFGKKRVFGQSGFTPEFSMEG
NEGASEARERWYFKLRCENSEYQTYCAAFEWVRQALKLNRAILNPSACAEVETPVLLFQS
GRDIWVLNKPQNHFVQLVKDGGGEANIVRFPESRHEIFSMPNSTYKPYLEKILGFYDDPM
IACAAY
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgggagccatgcaggtgacgatgatcgacgaaaacaagtacgccgaaacgatgaccgac
gtggtgctgcccgcgctcgaacaatgctgcgaggagggctggttcgatccgtccgccgcc
gaacgttcggccgggatcgagccgctgtccggcattatggacaccggcggccgctcgggc
cagctgcactacctgtgctacgactccgccaaattcgacgcgattcgcgagcaaggcgcc
accgccaccttccgcggggccatcgtcatcagccacggcttcaccgagttcgccgaaaag
tacgacgagctcgtctggtacttcctgcttgccggctactcggtgtgtgtactcgagcat
cgcggccacggcaagtccgcgcgcgacgtggacaaccgctgcatggtgtggattgatgac
tggcagcgctacgtggccgatctggccggcttcgccgaaaccatcggccagcagtacgcg
gccggcatgccgctgaacctgttctgccattcgatgggcggcggcatcggcgcggccgtg
ttggagcgataccccaccctgttcgacaaagcggtgctctctgccccgatgatcgccccc
gccaccggcatgccgctgggcgtggcccgtgtgctggtcggcgcgctgtgcggactcggc
ttcggcaagaagcgcgtgttcgggcagtcgggcttcacgccggaattctcgatggaaggc
aacgagggcgcttccgaagcgcgtgaacgctggtacttcaagctgcgttgcgagaatagc
gaataccagacctactgcgcggcgttcgaatgggtgcgccaagcgttgaagctcaaccgg
gccatactgaatccgtccgcctgcgccgaagtggagacgccggtgctgctcttccagtcc
ggacgcgacatctgggtactcaataagccgcagaatcacttcgtccaactggtcaaggac
ggcggcggcgaggcgaacatcgtgcgcttccccgaatcgcgccacgaaatcttctccatg
cccaacagcacttacaagccctacctcgaaaagatcctcggcttctacgacgaccccatg
attgcctgcgccgcgtactga

DBGET integrated database retrieval system