KEGG   Bifidobacterium longum subsp. longum JCM 1217: BLLJ_0106Help
Entry
BLLJ_0106         CDS       T01419                                 

Definition
sucrose phosphorylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
blm  Bifidobacterium longum subsp. longum JCM 1217
Pathway
Starch and sucrose metabolism
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:blm00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
137701..139227
Genome map
AA seq 508 aa AA seqDB search
MKNKVQLITYADRLGDGTLSSMTDILRTRFDGVYDGVHILPFFTPFDGADAGFDPIDHTK
VDERLGSWDDVAELSKTHNIMVDAIVNHMSWESKQFQDVLEKGEESEYYPMFLTMSSVFP
NGATEEDLAGIYRPRPGLPFTHYKFAGKTRLVWVSFTPQQVDIDTDSAKGWEYLMSIFDQ
MAASHVRYIRLDAVGYGAKEAGTSCFMTPKTFKLISRLREEGVKRGLEILIEVHSYYKKQ
VEIASKVDRVYDFALPPLLLHSLFTGHVEPVAHWTEIRPNNAVTVLDTHDGIGVIDIGSD
QLDRSLKGLVPDEDVDNLVNTIHANTHGESQAATGAAASNLDLYQVNSTYYSALGCNDQH
YLAARAVQFFLPGVPQVYYVGALAGRNDMELLRRTNNGRDINRHYYSTAEIDENLERPVV
KALNALAKFRNELPAFDGEFSYEVDGDTSITFRWTAADGTSTAALTFEPGRGLGTDNATP
VASLAWSDAAGDHETRDLLANPPIADID
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacaaagtgcaactcatcacatacgccgatcgtctcggcgatggcactcttagc
tcgatgaccgacatcctgcgcacccgcttcgacggcgtgtatgacggcgtgcatatcctg
ccgttcttcactccgttcgatggtgcggatgcaggcttcgacccgatcgaccataccaaa
gtcgacgaacgtctcggcagctgggacgacgtcgccgaactctccaagacccacaacatc
atggtcgacgccatcgtcaaccacatgagttgggaatccaagcagttccaagacgtgctt
gaaaaaggtgaggaatccgagtattacccgatgttcctgaccatgagctccgtcttcccg
aacggcgccaccgaagaagacctggccggcatctaccgcccgcgcccgggcctgccgttc
acccactacaagttcgccggcaagacgcgcttggtctgggtgagcttcaccccgcagcag
gtggacatcgacactgattccgccaagggttgggaatacctgatgtcgatcttcgatcag
atggccgccagccacgtgcgctacatccgtctcgacgccgtgggctacggcgccaaggaa
gccggcaccagctgcttcatgacccccaagacctttaagctcatctcccgtctgcgcgag
gagggcgtcaagcgcggccttgaaatcctcatcgaggttcacagctactacaagaagcag
gtggaaatcgcctccaaggtggaccgcgtctacgatttcgccctgccgccgctgcttctg
cactcgctgttcaccggtcacgtcgaacccgtggcccactggaccgagatccgcccgaac
aacgccgtcaccgtgctcgatacgcacgatggcatcggcgtgatcgacatcggctccgac
cagctcgaccgctccctcaagggcctcgtgcccgacgaggacgtcgacaacctggtcaac
accatccatgccaacacccacggcgaatcccaggccgccaccggtgccgccgcgtccaac
ctcgacctctaccaggtcaactccacgtactactcggccctcggctgcaacgaccagcac
tacttggccgcccgcgccgtgcagttcttcctgccgggcgtgccgcaggtctactacgtg
ggcgcgctcgccggccgcaacgacatggaactgctgcgccgcaccaacaacggccgcgac
atcaaccgccactactactccaccgccgaaatcgatgaaaacctcgaacgcccggtggtc
aaggccctgaacgccctggccaagttccgcaacgaactgcctgcattcgatggcgagttc
agctacgaggtcgatggcgacacgtccatcaccttccgctggaccgccgccgacggcacg
tccacggccgccctcaccttcgagcccggacgcggcctcggcacagacaacgccaccccg
gttgccagccttgcctggagcgatgccgccggcgaccacgaaacccgcgatctgctcgcc
aacccgccgattgccgatatcgactaa

DBGET integrated database retrieval system