KEGG   Bifidobacterium longum subsp. longum JCM 1217: BLLJ_0114Help
Entry
BLLJ_0114         CDS       T01419                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
blm  Bifidobacterium longum subsp. longum JCM 1217
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:blm00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BLLJ_0114
Enzymes [BR:blm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     BLLJ_0114
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(150234..152471)
Genome map
AA seq 745 aa AA seqDB search
MTDAYSNDAATSTGTIADTTNDAASGAPQRAESTERLARPLVKLAKACGLSTSFIDQLGT
YTEISDEALVAVLKALDVDASSDEAIKRSMTELEAENSKRLLPPTIVATTGKPTSLTLNC
PSDADITASIELEDGTAFGHFALLPNLNSGKPDLTIAPDLPMGYHTLTVTVDGREGKAAI
IAAPARIPVPEAVAEHQRWGWMTQMYSVRSRESWGIGDYGDLKLLLADAADKSKADFMLI
NPIHAGAPIPPLEPSPYLPESRRFLNVTYIRPQDIPEYGTLPADIRAQVDALHDSVAARN
DESNPMDINAAWAAKRPALRLIFDAGRNNKRELEFEHFKTTAGPDLDSFATWCLCFEVWG
APWGENRWFFEKTIDDPAVRQLVEEHHDLFEFNRWLQWIAAEQVNAAQQEALDHGMTLGL
MQDMAVGVHGLGADAWANPERFASGGVTVGCPPDFYNQQGQDWGQPPFSPRYLEATGYQV
YREMVHSMYEHAGAVRIDHVLGLFRLWWIPQGLGALNGAYVTYNHEAMLGVLAIEATRAG
GMVVGEDLGTVPDYVRRILADHGVLGTDVEWFNRVDDSPNAGDPYRAPEDYRKQALASVT
THDLPPTAGYLNFEHVKLREELHLLSEPVEAFAASAMAERTAMMNRLVENGYISQTVADD
VEGHVQEIVEAMHAMLTDTPSLLLQAALVDGVGECRSQNQPGTSREYSNWRVPLADSSGH
VVHTDEVFDLPRVQSLAAVMRREKR
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgcgtacagcaacgacgcagcgaccagcaccggcaccatcgcagacaccacc
aacgacgccgcttccggtgccccgcagcgcgcggaaagcacggaacgactcgcccgtccg
ctggtcaagctggccaaagcatgcgggctttccacctcgttcatcgaccagctcggcacc
tacaccgaaatcagcgacgaggccttggtcgccgtgctcaaggccctcgatgtggacgcc
tccagcgacgaggccataaaacgttccatgaccgaacttgaggccgaaaacagcaaacgt
ttgctaccacccaccatcgtggccaccaccggcaagccgacaagcctgaccctgaattgc
ccgtcggacgcggacatcaccgcctccatcgagctggaggacggcaccgcgtttggccac
tttgccctgctgccgaacctcaattccggcaagccggacttgaccatcgcccccgatctg
ccgatgggctaccacacactgaccgtcacggtggacgggcgcgagggcaaggcggccatc
atcgccgcccccgcgcgcattcccgtgccggaggcggtcgccgagcaccagcggtggggc
tggatgacgcagatgtattccgtgcggtcccgcgaatcgtggggcatcggcgattacggc
gatctgaagctgctgctggcggacgcggccgacaagtccaaagccgacttcatgctcatc
aacccgattcacgccggcgcgccgattccgccgcttgagccatcgccgtatctaccggaa
tcgcgccgattcctcaacgtgacgtacatccgcccgcaggacatccccgaatacggcacg
ctgccggccgatatccgagcgcaggtggatgcgctgcatgattcagtggccgcacgcaac
gacgaatcgaacccgatggacatcaacgcggcgtgggcggccaaacgcccggcgctgcgc
ctgatcttcgacgcgggccgcaacaacaagcgcgagctcgaattcgagcatttcaagacc
accgccggcccagacctcgattccttcgccacctggtgcctgtgcttcgaggtatggggc
gcgccgtggggcgagaaccgttggttcttcgagaagaccatcgacgacccggccgtgcgc
cagctcgtcgaggagcaccacgacctgttcgagttcaaccgctggctgcagtggattgcc
gccgagcaggtgaacgccgcgcagcaggaggcgctggaccacggcatgacactgggtctg
atgcaagacatggccgtgggcgtgcacgggctcggcgcggatgcctgggccaatccggaa
cgcttcgcctccggcggcgtcacggtcggctgcccgccggacttctataaccagcagggc
caggattggggccagccgccgttcagcccacgctatctggaggccaccggctaccaggtg
taccgcgagatggtgcattcgatgtacgagcacgcgggcgcggtgcgcatcgaccatgtg
ctgggcctgttccgcctgtggtggattccgcaggggctcggcgccctcaacggcgcatac
gtaacgtacaaccacgaagcgatgctgggagtactggccatcgaagccacgcgcgccgga
ggcatggtggttggcgaggatctgggcaccgtgccggattacgtgcgccgcattctggca
gatcacggcgtactcggcactgacgtggaatggttcaaccgcgtggacgattcgccgaac
gccggcgacccgtaccgcgcacccgaggactaccgcaagcaggcattggcctcggtgacc
acgcacgatctgccacccaccgccggctacctgaacttcgaacacgtcaagctacgcgag
gagctgcatctcctgagcgagccggtggaggcgttcgccgcctcggcgatggccgaacgc
acggccatgatgaaccgtctggtggagaacggctatatctcgcagaccgtggcggatgat
gtggaaggccatgtgcaggaaatcgtggaagcgatgcacgccatgctcaccgatacgccg
tcgctgctgctgcaggcagcgttggtggacggcgtgggcgaatgccgttcccagaatcag
ccgggcacttccagagagtattcgaactggcgcgtgccgctggcggacagctcaggccac
gtggtacataccgacgaggtcttcgacctgccacgcgtgcagtccctagccgccgtgatg
cgccgagagaagcggtga

DBGET integrated database retrieval system