KEGG   Bifidobacterium longum subsp. longum JCM 1217: BLLJ_0139Help
Entry
BLLJ_0139         CDS       T01419                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
blm  Bifidobacterium longum subsp. longum JCM 1217
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:blm03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
180381..180983
Genome map
AA seq 200 aa AA seqDB search
MALAYDGAIQRLIDAFGRLPGIGPKGAQRIAFYMLSAPEDEARDLAEAIEEVKAKIRFCD
ICGNVCESSPCPVCADPRRDRSVICVVEEPKDVMSIERTREYHGLYHVLGGAINPMANVG
PADLRIPGLLKRLEGDEVKEVIMALDPNIEGEATTSYLTQLLRPVGVKVTRLASGLPVGS
DLEYADEITLGRALAGRREA
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggcacttgcttatgacggcgcaatacaacgactgatcgacgctttcgggcggctgccc
ggcatcgggccgaagggcgcgcagcgtatcgccttctacatgctgtccgcgcccgaagat
gaagcgcgcgatttggccgaggccatcgaagaggtcaaggccaagatccgcttctgtgat
atttgcggcaacgtgtgcgaatccagcccctgcccggtatgcgccgacccgagacgcgac
cgttcggtgatctgcgtggtcgaagagcccaaggatgtgatgagcatcgagcgcacgcgc
gaataccacggcctataccatgtgctcggcggcgcaatcaacccaatggccaacgttggc
cctgccgacctgcgtattcccggtctgctcaaacgcttagaaggcgatgaggtcaaggaa
gtgattatggcgctcgacccgaatattgaaggcgaggccaccaccagctacttgacccag
ctattgcgacccgtaggtgtcaaggtcacccgacttgccagcggcctgccggtgggctcc
gacttggagtatgccgacgaaatcacgctgggcagggcactggccggtcggcgcgaggcc
taa

DBGET integrated database retrieval system