KEGG   Bifidobacterium longum subsp. longum JCM 1217: BLLJ_0163Help
Entry
BLLJ_0163         CDS       T01419                                 

Definition
hypothetical protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
blm  Bifidobacterium longum subsp. longum JCM 1217
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:blm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BLLJ_0163
Enzymes [BR:blm01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     BLLJ_0163
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
210464..211381
Genome map
AA seq 305 aa AA seqDB search
MVKNIAYATEEETLMGNGVNLRTLTNDGGSAVISDYGAHLLRWAPAGQPDVIWTPRTWHF
EAGQPVGGGVPVCFPWFGPGFVHGGQTAKRPIHGFARLRQWALDEGAFTGARVRYVLDSE
RLTTGEVPWIEDEPNVRFHAAYEVCASDTLTMTLTVTNTGGEPMSYEAALHSYLHVGDVL
GARLVGLRGATYLDATEAGFPPKLQEQPSVMFGDQPVDRVYYSDAALELQDHVLGRVIRI
GKTGSPQTVVWNPGEQGGNAIAHAKTGEWRGFVAVEAAACRDRIVALSPGESYMLSQSIA
VMPLG
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
gtggtgaagaacatcgcttacgcaacggaagaagaaacacttatgggcaatggcgtcaat
ctgcgcacgctcaccaatgacggcggtagcgcggtaatcagcgattacggggcgcatctg
ctgcgctgggccccggcggggcagccggatgtaatctggacgccccgcacatggcatttc
gaagctggtcagccggttggcgggggagtgccggtgtgcttcccctggttcgggccgggg
tttgtgcatggcgggcagactgcgaagcgaccgattcatgggttcgcacgattgcgccag
tgggcgctggacgaaggggcgtttaccggtgcccgtgtgcggtatgtgctggattccgaa
cgactgacgactggcgaagtgccatggatcgaggatgaacccaacgtgcgtttccatgcc
gcatacgaggtgtgtgccagcgatacgctgacgatgacgctgaccgttaccaacacggga
ggtgagccgatgtcgtatgaggcggcgctgcactcgtatctgcatgtcggcgatgtgctc
ggcgcgcggctggtcggtttgcggggtgcaacatatctggatgccacggaagccggattc
ccgccaaaactacaagaacagccatcggtgatgttcggcgatcagccggtggaccgtgtg
tattattccgatgctgcactggaattgcaggaccatgtgctgggtcgtgtgattcgcatc
ggcaagaccggctcgccgcagacggtggtgtggaatcccggagagcagggcggcaacgcc
attgcccatgccaagacgggtgaatggcgtggctttgtggccgtggaggcagcggcgtgc
cgagaccgtatcgttgcccttagtccgggtgaatcgtatatgctttcgcagtccattgcc
gtgatgccgttggggtag

  All links  
No link information was found.   
DBGET integrated database retrieval system