KEGG   Bifidobacterium longum subsp. longum JCM 1217: BLLJ_0163Help
Entry
BLLJ_0163         CDS       T01419                                 

Definition
hypothetical protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
blm  Bifidobacterium longum subsp. longum JCM 1217
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:blm00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
210464..211381
Genome map
AA seq 305 aa AA seqDB search
MVKNIAYATEEETLMGNGVNLRTLTNDGGSAVISDYGAHLLRWAPAGQPDVIWTPRTWHF
EAGQPVGGGVPVCFPWFGPGFVHGGQTAKRPIHGFARLRQWALDEGAFTGARVRYVLDSE
RLTTGEVPWIEDEPNVRFHAAYEVCASDTLTMTLTVTNTGGEPMSYEAALHSYLHVGDVL
GARLVGLRGATYLDATEAGFPPKLQEQPSVMFGDQPVDRVYYSDAALELQDHVLGRVIRI
GKTGSPQTVVWNPGEQGGNAIAHAKTGEWRGFVAVEAAACRDRIVALSPGESYMLSQSIA
VMPLG
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
gtggtgaagaacatcgcttacgcaacggaagaagaaacacttatgggcaatggcgtcaat
ctgcgcacgctcaccaatgacggcggtagcgcggtaatcagcgattacggggcgcatctg
ctgcgctgggccccggcggggcagccggatgtaatctggacgccccgcacatggcatttc
gaagctggtcagccggttggcgggggagtgccggtgtgcttcccctggttcgggccgggg
tttgtgcatggcgggcagactgcgaagcgaccgattcatgggttcgcacgattgcgccag
tgggcgctggacgaaggggcgtttaccggtgcccgtgtgcggtatgtgctggattccgaa
cgactgacgactggcgaagtgccatggatcgaggatgaacccaacgtgcgtttccatgcc
gcatacgaggtgtgtgccagcgatacgctgacgatgacgctgaccgttaccaacacggga
ggtgagccgatgtcgtatgaggcggcgctgcactcgtatctgcatgtcggcgatgtgctc
ggcgcgcggctggtcggtttgcggggtgcaacatatctggatgccacggaagccggattc
ccgccaaaactacaagaacagccatcggtgatgttcggcgatcagccggtggaccgtgtg
tattattccgatgctgcactggaattgcaggaccatgtgctgggtcgtgtgattcgcatc
ggcaagaccggctcgccgcagacggtggtgtggaatcccggagagcagggcggcaacgcc
attgcccatgccaagacgggtgaatggcgtggctttgtggccgtggaggcagcggcgtgc
cgagaccgtatcgttgcccttagtccgggtgaatcgtatatgctttcgcagtccattgcc
gtgatgccgttggggtag

DBGET integrated database retrieval system