KEGG   Bifidobacterium longum subsp. longum JCM 1217: BLLJ_0352Help
Entry
BLLJ_0352         CDS       T01419                                 

Definition
beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
blm  Bifidobacterium longum subsp. longum JCM 1217
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:blm00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
444991..447150
Genome map
AA seq 719 aa AA seqDB search
MTTRRTFRWPSLLTESGRGIAFGGDYNPDQWPEETLDEDIRLMVQAGVNTVALAIFSWDK
IEPREGEFTFEWLDHVIDKLGAASIAVDLASATATAPLWLYERHPEVLPIDRYGHVVNAG
SRQSWQPTSPVLKEYALRLCRKLAEHYKDNPYVTAWHMGNEYGWNNRYDYSDNALAAFRT
WCEAKYGTVDALNEAWGTAFWSQHVNSFDEVLLPRHMGGDSMVNPPQQLDYERFGNDMLL
DFYKAERDAIEEICPGKPFTTNFMVSTDQCTMDYAQWANEVDFVSNDHYFHEGESHLDEL
ACSDALMDSLALGKPWYVMEHSTSAVQWKPLNTRKRAGELMRDSLAHVAMGADAINFFQW
RQSASGAEAFHSAMVPHAGSDTKLFRGVCELGAALKTLSDAGVQDTELKRADTAILFSAE
SEWATRSETLPSMKLNHWHDVRDWYRGYLDAGARADVVPLAYDWSGYQTIVLPTVIALSD
EDTRRIADFAENGGTVIVGYATGLIDEHFHIGLGGYPGAGNGLLRDMLGIRSEEFNILGE
EAEDEPAEIGLSNGLTTRLWQNDVTSVAPDTRVLATYVGTAAADWELDGVPAITSHPHGQ
GAAIYVGCDLGRHDITHLLKELNTTAPSDERAPDQRPGGGEINAATTTAAATTHDPRILH
TIRQSSDGTIRFDFYLNRSKQPVAVNGVEGDPIIAHRCETDAVGYTLNRNAILIAKTSC
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atgactactcgtagaacgttcaggtggccgtccctgctgactgaatccggtcgtggcatc
gcgttcggcggcgactacaatccggaccagtggcccgaggagacactggacgaggacatt
cgcctgatggtccaagccggcgtcaacaccgtggccctcgccatcttcagctgggacaag
atcgaaccgcgcgagggcgagttcacgttcgagtggcttgaccacgtgatcgacaagctc
ggcgcggcgagcatcgccgtggacctggcatcggccactgccacggccccgttgtggctg
tacgagcgtcatcctgaggtgctgccaatcgatcggtacggccatgtggtcaatgcgggc
tcacgccagtcgtggcagcccacaagcccggtgctcaaggaatacgcgctgcgcctgtgc
cgcaaacttgccgaacactacaaggacaatccatacgtgacggcctggcacatgggcaac
gaatacggctggaacaaccgctacgactactccgacaacgccttggccgcgttccgcacg
tggtgcgaggccaaatacgggaccgtcgacgcgttgaacgaagcgtggggcacggccttc
tggtcccagcacgtgaacagcttcgacgaggtgttgctgcctcgccacatgggcggcgac
agcatggtcaacccgccccagcagttggattacgagcggttcggcaacgacatgctgctc
gacttctacaaggccgaacgcgacgccatcgaagaaatctgccccggcaagccgttcacc
acgaacttcatggtctccaccgaccaatgcaccatggactacgcgcaatgggcaaacgaa
gtggacttcgtgtccaacgatcactacttccatgagggcgaatcccatctggacgaactc
gcctgctcggacgcgctcatggactcgctcgcgctcggcaagccgtggtacgtgatggag
cactccacctccgccgtccaatggaagccgcttaacacgcgcaagcgcgccggcgagctc
atgcgcgactccttggcccacgtggccatgggtgccgacgccatcaacttcttccaatgg
agacaatccgcatcgggtgccgaggcgttccactccgcgatggtgccccacgcgggctcc
gatacgaaactgtttcgaggagtgtgcgaactcggcgccgcgctgaagacgctgtccgac
gcgggtgtgcaagacacggaactgaagcgcgcggacacggcgattctgtttagtgcggaa
tccgaatgggccactcgctccgagaccctgcccagcatgaaactcaatcactggcatgac
gtacgcgactggtatcgcggatatctcgatgccggagcgcgcgcggacgtggtcccgctc
gcctacgattggagcggctaccagactatcgtgctgcccaccgtgatcgccctgtccgac
gaggatacccgtcgcatcgcggactttgccgaaaacggcggtacggtcatcgtcggctat
gccaccggcctgatcgacgaacacttccacatcggtctcggcggataccccggcgccggc
aacggacttctgcgcgacatgctcggcatccgctccgaagaattcaacatcctcggagaa
gaagccgaagacgaaccggccgaaatcggtttgtcgaatggactcacgacacgtctgtgg
cagaatgacgtgacctcggtcgctccagacactcgcgtgcttgccacgtacgtgggtaca
gccgctgctgactgggagctcgacggcgtccccgccatcaccagtcacccccacggccaa
ggcgccgccatctacgtgggctgcgatcttggccgccacgacatcacccacttgctcaag
gaactcaacacaacagccccctccgacgaaagggctcccgaccaaaggccgggtggggga
gagatcaacgccgcaactacgaccgcagcagccacgactcatgacccccgcatcctgcac
accatccgccaatcctcagacggtaccatccgcttcgatttctatctgaaccgttcgaag
cagcccgttgccgtcaacggtgtggaaggtgatcccatcatcgcccaccgttgcgagact
gacgccgttggatatacgctgaaccgcaacgccattcttatcgctaaaacgtcctgctaa

DBGET integrated database retrieval system