KEGG   Bifidobacterium longum subsp. longum JCM 1217: BLLJ_0443Help
Entry
BLLJ_0443         CDS       T01419                                 

Definition
beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
blm  Bifidobacterium longum subsp. longum JCM 1217
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:blm00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BLLJ_0443
Enzymes [BR:blm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     BLLJ_0443
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
571351..573426
Genome map
AA seq 691 aa AA seqDB search
MERKEFKWPQPLAGNEPRIWYGGDYNPDQWPEEVWDEDIELMQQAGVNLVSVAIFSWAKL
EPEEGVYDFDWLDRVIDKLGKAGIAVDLASGTASPPMWMTQAHPEILWVDYRGDVCQPGA
RQHWRATSPVFLDYALNLCRKMAEHYKDNPYVVSWHVSNEYGCHNRFDYSEDAERAFQKW
CEKKYGTIDAVNDAWGTAFWAQRMNNFSEIIPPRFIGDGNFMNPGKLLDWKRFSSDALLD
FYKAERDALLEIAPKPQTTNFMVSAGGAGIDYDKWGYDVDFVSNDHYFTPGEAHFDELAY
SASLCDGIARKNPWFLMEHSSSAVNWRPINYRVEPGELVRDSLAHLAMGSDAICYFQWRQ
SKAGAEKWHSSMVPHAGPDSQIFRDVCELGADLNKLADEGLLSTKLVKSKVAVVFDYESQ
WATEHTATPTQEVRHWTEPLAWFRALADNGLTADVVPVRGPWDEYEAVVLPSLTILSEET
TRRVREYVANGGKLFVTYYTGLVDDKDHVWLGGYPGSIRDVVGVRVEEFAPMGNDFPGAM
DHLDLDNGTVAHDFADVITSVADTAHVVASFKADKWTGFDGAPAITVNDFGDGKAAYVGA
RLGREGLAKSLPVLLEELGIETSAEDDRGEVLRVERADETGENHFVFLFNRTHDVAVVDV
EGEPLVASLAQVNESEHTAAIQPNGVLVVKL
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
atggaacgtaaagagttcaagtggccgcagcctcttgcgggcaacgagccccgcatctgg
tacggcggcgactacaaccccgaccagtggccggaggaagtctgggacgaagacatcgag
cttatgcagcaggccggcgtcaacctcgtctccgtagccatcttctcctgggccaagctt
gagcccgaagaaggcgtgtacgacttcgattggctcgatcgcgtcatcgacaagctcggc
aaggccggcatcgccgtcgatctcgcctccggcaccgcatccccgccgatgtggatgacc
caggcccacccggagatcctctgggtcgactaccgcggcgacgtctgccagcccggtgcc
cgccagcactggcgcgccaccagcccggtcttccttgactacgcgctcaacctgtgccgc
aagatggccgagcactacaaggacaacccctatgtggtctcttggcatgtgagcaacgag
tacggctgccacaaccgcttcgactattccgaagacgccgagcgcgccttccagaagtgg
tgcgagaagaagtacggcaccatcgacgctgtcaacgacgcttggggaaccgcattctgg
gcgcagcgcatgaacaatttttccgagatcatcccgccgcgcttcatcggcgacggcaac
ttcatgaacccgggcaagctgcttgactggaagcgcttcagctccgacgccctgctcgac
ttttacaaggccgagcgcgacgccctgctcgagatcgcccccaagccgcagaccaccaac
ttcatggtctccgccggcggtgccggcatcgattacgacaagtggggttacgacgtggac
ttcgtgtccaacgatcactacttcacgcctggcgaagctcacttcgacgagctggcttac
tcggcctccctatgtgacggcatcgcccgcaagaatccgtggttcctcatggagcactcc
agctccgccgtcaattggcgcccgatcaactatcgcgtcgagcccggcgaattggtgcgc
gactccctggcccacttggccatgggctccgacgccatctgctacttccagtggcgccag
tccaaggccggtgccgagaagtggcactcttcgatggttcctcacgcgggccccgactcc
cagatcttccgcgatgtgtgcgagctgggtgccgacctcaacaagcttgctgacgagggc
ctgctgagcaccaagctggtcaagtccaaggtcgccgtcgtcttcgattacgagtcccag
tgggctacggaacacaccgccacgcctactcaggaggtacgccattggaccgagccgctc
gcgtggttccgcgcgctggcggacaacggtctgactgcagacgtggtgccggttcgcggc
ccttgggacgagtacgaagccgtcgtgctgccgagcctgaccatcctgtccgaagagacc
acgcgccgcgtgcgcgagtatgtggcgaacggcggcaagctgttcgtgacctactacacc
ggtctggtggacgacaaggatcacgtctggctgggtggctaccccggttccatccgtgac
gtggtgggtgtgcgcgttgaggaattcgccccgatgggcaacgacttccccggtgccatg
gaccaccttgacttggacaacggaaccgtggcgcacgatttcgccgacgtgatcacctcc
gtggccgataccgctcacgtggtcgcctccttcaaggcagataagtggaccggtttcgac
ggcgctcccgccatcaccgtcaacgacttcggcgacggcaaggccgcatacgtcggtgcc
cgtctcggccgtgagggtttggccaagagcctgcccgtgctgctggaggaactcggcatc
gagacttcggctgaggacgatcgcggtgaagtgctgcgcgtcgagcgtgcggacgaaact
ggcgagaaccacttcgtgttcctgttcaaccgcacccacgatgttgcggtcgtggacgtg
gaaggcgaaccgctggtcgcctcgctggcccaggtcaacgagtccgagcacacggccgcc
atccagcccaacggcgtactcgtcgtcaagctgtaa

DBGET integrated database retrieval system