KEGG   Bifidobacterium longum subsp. longum JCM 1217: BLLJ_0522Help
Entry
BLLJ_0522         CDS       T01419                                 

Definition
alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
blm  Bifidobacterium longum subsp. longum JCM 1217
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:blm00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BLLJ_0522
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BLLJ_0522
  Lipid metabolism
   00071 Fatty acid degradation
    BLLJ_0522
  Amino acid metabolism
   00350 Tyrosine metabolism
    BLLJ_0522
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BLLJ_0522
   00626 Naphthalene degradation
    BLLJ_0522
Enzymes [BR:blm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BLLJ_0522
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
672823..673866
Genome map
AA seq 347 aa AA seqDB search
MSETMKAAIFVEPGKMTVEEVPKAALQQDDDIVIRMVRTCVCGSDLWFFRGLSGQAAHSQ
VGHEAIGVVEETGAAVESVKPGDFVVVPFPYSCGKCPVCKAGFESVCPHGGYFSACQAEY
LRVPEADGTVVKVPGSPEDYSDEQLASLLTISDVMSTGYHAAVSAEVKPGDTAVVMGDGA
VGLCGVIAAKMRGATRIIAMSRHEDRAALAREFGATDIVPERGQEAIDKVLEMTGGYGAD
AVLECVGSKQSFDTAIGLIRRGGVIGRVGLPHDVEISAEGTFYGNIGIKGGPAPVRHYDI
DGGLLDAVLKGEINPGRVFTAEYDLDHIQDAYEAMDQRKVIKALIRF
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaaccatgaaagccgcgattttcgttgagcctggcaagatgaccgtggaagaa
gtgccaaaggcggcacttcagcaggatgatgacatcgtgattcgcatggtgcgcacctgt
gtatgcggctctgatttgtggttcttccgtgggctgagcggacaggccgcacacagtcag
gtgggccacgaagccattggcgtggtcgaggagactggcgcggcggtcgaatccgttaag
ccaggtgatttcgtggtcgtgccattcccgtacagctgcggcaagtgcccggtatgcaag
gccggcttcgaatccgtgtgcccgcacgggggctacttctccgcttgtcaggccgaatac
ctgcgtgtgcccgaggcggacggcaccgtggtcaaggtgcccggttcaccggaagattat
tccgatgaacagctcgcatcgctgctgaccatttccgatgtgatgtccaccggttatcac
gcggcggtttctgccgaggtcaagcccggtgacacagccgtggtcatgggcgatggtgca
gtcggcctgtgcggtgtgattgccgccaagatgcgtggtgccacgcgcattattgccatg
agccgtcacgaggatcgcgcggcgctcgcccgcgaattcggtgcgactgatatcgtgccc
gagcgtggccaagaggctattgacaaggtgctggagatgaccggtggctatggtgcggac
gcggtgctcgaatgcgtgggctccaagcagtccttcgacacggcgattggcctgattcgc
cgcggtggcgtgattggtcgtgtgggtctgccgcacgacgtggagatcagcgccgaaggc
acgttctacggcaacatcggcatcaagggcggcccggctcccgtgcgccactacgatatt
gacggtggtctgctggatgcggtgcttaaaggcgagattaaccctggccgcgtgttcacc
gccgaatatgacctcgaccatattcaggacgcttatgaggccatggaccagcgcaaagtt
attaaggcgttgatccggttctaa

DBGET integrated database retrieval system