KEGG   Bifidobacterium longum subsp. longum JCM 1217: BLLJ_0622Help
Entry
BLLJ_0622         CDS       T01419                                 

Definition
glycosyl hydrolase
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
blm  Bifidobacterium longum subsp. longum JCM 1217
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:blm00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BLLJ_0622
Enzymes [BR:blm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     BLLJ_0622
Exosome [BR:blm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BLLJ_0622
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(782433..784685)
Genome map
AA seq 750 aa AA seqDB search
MAKETKIKEDTVTVPVAQGDLDATSNAEFYNPHGVLGGHLGIGKHADTATIRVLRPLAKS
VTILTQDGEYPMTHEYNGVFVVTVPASGTKKQPTIPDYRVRTEWESGAVLIEDDPYRYMP
TVGDMDTYLFGEGRHEKLWETLGAHVLRYDDPMGGADGTPGEQVVGTAFSVWAPNAHAVR
VVGNFNAWDGRRHAMRELGSSGVWEIFIPGIGAGETYKFQILNANYTWEMKADPMERQHE
VPPNTASIVTESTYKWNDDAWMQHRRTTNPHDGPVSIYEVHAGSWRQGLTYRDLAKQLVD
YVKQEGFTHVEFMPLAQHPFSGSWGYQVTGYYAVDSRLGSPDDFRYLVDQFHQAGIGVIM
DWVPAHFPKDAFALGRFDGTPLYEDPDPLRGEHPEWGTYVFNFGRREVRNFLVANALFWL
EDLHVDALRVDAVSSMLYLDYSREPGHWRPNIYGGRENLEAIDFLKEATATAYKNNPGVM
VIAEESTAWPGITAPTSAGGIGFGMKWNMGWMHDTLEYLHEEPINRKWHHNEITFSMVYA
YSEHYVLPISHDEVVYGKGSLYGKMPGDDWQKLAGVRSMFAYQWAHPGKKLSFMGNELAQ
WGEWDHDASIDWDCLNWQEHRQVQTMVADLNAFYKAHPALWSQDFDPAGFQWLTSDDADH
NTLSFLRIGTKGETLAVVVNFSGEAWSDYQVALPTGGKWTEVFTTDDAKYGGSDIHNGTF
EAVEGEYHSRPFSAKITVPALGVVFLKPED
NT seq 2253 nt NT seq  +upstreamnt  +downstreamnt
atggccaaagaaacgaaaatcaaggaagataccgtcaccgtgcctgtcgcccaaggcgac
ctcgatgcgacgagcaatgctgaattctacaacccccacggagttctcggcgggcatctc
ggcatcggcaagcatgccgacaccgccacaatccgcgtgctgcgtccgcttgccaagtcc
gtgaccatcctcacccaggatggcgaatacccgatgacccacgaatacaacggcgtgttc
gtggttaccgtgccggcttccggcactaagaagcagcccacgattcccgactaccgtgtc
aggaccgagtgggaaagcggcgcagtgctcattgaggacgacccatatcgctatatgccc
acagtcggtgacatggacacctatctgttcggcgagggccgtcacgagaagctctgggag
acgcttggcgcgcatgtgctgcgctatgacgatccgatgggcggcgcagacggcacgccc
ggcgaacaggtggtaggcaccgcattctccgtgtgggccccgaacgcccatgccgtgcgc
gtagtcggtaacttcaacgcttgggatggccgccgtcatgccatgcgcgagctcggctcc
tccggcgtgtgggagatcttcatccccggaatcggcgcgggcgagacctacaagttccag
atcctgaacgccaattacacgtgggagatgaaggctgacccgatggagcgtcagcacgaa
gttccgccgaacaccgcctccatcgtcaccgaatccacctacaagtggaacgatgacgcc
tggatgcagcaccgccgcaccaccaacccgcatgatggcccggtctccatctatgaggtg
cacgccggcagctggaggcagggactgacctaccgcgacctggccaagcagctcgtggac
tacgtcaagcaggaaggcttcacccacgtggagttcatgccactggcccagcacccgttc
tccggctcctggggctatcaggtcaccggctactatgcggtcgactcccgtctcggttcc
cccgacgacttccgttacctggtcgaccagttccatcaggccggcatcggcgtgatcatg
gactgggtgcccgcccacttcccgaaggatgccttcgcgctcggccgcttcgacggcacc
ccgctgtacgaggacccggacccgctgcgcggcgaacaccctgaatggggcacctatgtg
ttcaacttcggacgccgcgaagtacgcaacttcctggtggccaacgccctgttctggctt
gaggacctgcacgtcgatgcactgcgcgtggatgccgtcagctccatgctctacctcgac
tacagccgcgaacccggccattggcgcccgaacatctacggcggacgcgagaacctggag
gccatcgacttcctcaaggaggccaccgccaccgcgtacaagaacaaccccggcgtcatg
gtgatcgccgaggagtccaccgcatggccgggcatcaccgcccccacttccgccggcggc
atcggcttcggcatgaagtggaacatgggctggatgcacgacaccctcgagtatctgcac
gaggagcccatcaaccgcaagtggcaccacaacgagatcaccttctccatggtgtacgcc
tactccgaacactacgtattgcccatcagccacgacgaagtcgtgtacggcaagggttcc
ctgtacggcaagatgccgggcgatgactggcagaagctggccggcgtgcgttcgatgttc
gcctatcagtgggctcacccaggcaagaagctctccttcatgggcaacgagctggcccag
tggggcgagtgggatcacgacgcctccatcgattgggattgcctgaactggcaggagcac
cgtcaggtccagaccatggtcgccgaccttaacgccttctacaaggcgcatccggcacta
tggagccaggacttcgacccggccggcttccagtggctgaccagcgacgatgccgaccac
aacacgctgagcttcctgcgcatcggtaccaagggcgagaccttggccgtggtggtcaac
ttctccggtgaggcctggtccgattaccaggtggcgctgcccaccggcggcaagtggacc
gaagtgttcaccaccgatgacgccaagtacggcggctccgacatccacaacggcaccttc
gaagcggtcgagggcgaatatcattcacgtccgttctcggcgaagatcaccgttccggct
ctgggagttgtattcttgaagccggaagactga

DBGET integrated database retrieval system